Comparing H281DRAFT_06483 FitnessBrowser__Burk376:H281DRAFT_06483 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1yw4A Crystal structure of the succinylglutamate desuccinylase from chromobacterium violaceum, northeast structural genomics target cvr22.
47% identity, 86% coverage: 38:338/350 of query aligns to 24:312/319 of 1yw4A
2bcoA X-ray structure of succinylglutamate desuccinalase from vibrio parahaemolyticus (rimd 2210633) at the resolution 2.3 a, northeast structural genomics target vpr14
34% identity, 87% coverage: 37:341/350 of query aligns to 25:326/338 of 2bcoA
>H281DRAFT_06483 FitnessBrowser__Burk376:H281DRAFT_06483
MTSSAERHAQHAMLDDFLAYTLAGTRPSANETHGTCGGGVRWSWLDEGVLLMEPAAITAD
TRSVLASAGVHGDETAPIELLSHLVRDMARGEAALTCRLLVILGNVDAMRDACRYRDDDL
NRLFSGRHLQLPHSYEAPRAAALEQAATQFFATASRQPGARWHIDMHTAIRASAFERFAL
LPHTGRPFSRAMFEWLAEARISAVLLHTTKGNTYSHFTAQACEAEACTLELGKVRPFGQN
DLTRFAGADAALRHLLAGTSGREQAELPRAFTVIDQITKPSEAFELLVAPDVANFTPFGK
GTLLARDGDYRYVVQHDEERLVFPNATVKPGLRAGLMVIETTHDTLAKLV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory