SitesBLAST
Comparing H281DRAFT_06497 FitnessBrowser__Burk376:H281DRAFT_06497 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 99% coverage: 4:374/374 of query aligns to 28:391/398 of Q8ZL58
- DAK 46:48 (≠ --K 18) binding
- KR 82:83 (≠ GN 52:53) binding
- K195 (= K168) binding
- K197 (= K170) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D199) binding
- N228 (= N201) binding
- E252 (= E226) binding
- E278 (= E252) binding
- H328 (= H302) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E322) binding
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
34% identity, 91% coverage: 34:374/374 of query aligns to 61:388/395 of 2pp1A
- active site: S78 (≠ V51), K192 (= K168), K194 (= K170), D223 (= D199), N225 (= N201), E249 (= E226), G274 (≠ A251), E275 (= E252), D298 (= D275), H325 (= H302), E345 (= E322)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: K79 (≠ G52), F168 (≠ Y143), K194 (= K170), E275 (= E252), H325 (= H302), E345 (= E322)
- binding magnesium ion: D223 (= D199), E249 (= E226), E275 (= E252)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
32% identity, 99% coverage: 4:374/374 of query aligns to 25:388/395 of 2pp3A
- active site: K45 (= K18), S78 (≠ V51), K192 (= K168), A194 (≠ K170), D223 (= D199), N225 (= N201), E249 (= E226), G274 (≠ A251), E275 (= E252), D298 (= D275), H325 (= H302), E345 (= E322)
- binding l-glucaric acid: D43 (vs. gap), K79 (≠ G52), K192 (= K168), D223 (= D199), N225 (= N201), E275 (= E252), H325 (= H302), E345 (= E322), F347 (= F324)
- binding magnesium ion: D223 (= D199), E249 (= E226), E275 (= E252)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
33% identity, 93% coverage: 22:367/374 of query aligns to 11:348/351 of 5olcC
- active site: K148 (= K168), K150 (= K170), D178 (= D199), N180 (= N201), E204 (= E226), G229 (≠ A251), E230 (= E252), D253 (= D275), H280 (= H302), E304 (= E322), E309 (≠ L330)
- binding magnesium ion: D178 (= D199), E204 (= E226), E230 (= E252)
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
33% identity, 87% coverage: 34:359/374 of query aligns to 40:356/373 of 3cb3A
- active site: S57 (≠ V51), T143 (≠ S139), K171 (= K168), K173 (= K170), D202 (= D199), N204 (= N201), E228 (= E226), G253 (≠ A251), E254 (= E252), M275 (≠ Q273), D277 (= D275), H304 (= H302), F305 (≠ W303), A306 (≠ F304), E324 (= E322)
- binding l-glucaric acid: K171 (= K168), K173 (= K170), D202 (= D199), E254 (= E252), H304 (= H302)
- binding magnesium ion: D202 (= D199), E228 (= E226), A243 (= A241), F246 (≠ T244), E254 (= E252)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
32% identity, 92% coverage: 15:359/374 of query aligns to 1:345/363 of 2og9A
- active site: S46 (≠ V51), T132 (≠ S139), K160 (= K168), K162 (= K170), D191 (= D199), N193 (= N201), E217 (= E226), G242 (≠ A251), E243 (= E252), M264 (≠ Q273), D266 (= D275), H293 (= H302), F294 (≠ W303), A295 (≠ F304), E313 (= E322)
- binding calcium ion: A232 (= A241), F235 (≠ T244)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
31% identity, 91% coverage: 26:367/374 of query aligns to 24:366/376 of 3bjsB
- active site: P49 (≠ V51), S52 (≠ A54), L93 (≠ M96), G136 (= G140), K164 (= K168), R166 (≠ K170), D194 (= D199), N196 (= N201), E220 (= E226), G246 (≠ A251), E247 (= E252), N248 (≠ I253), Q268 (= Q273), D270 (= D275), H297 (= H302), S298 (vs. gap), S299 (vs. gap), E322 (= E322), C324 (≠ F324), K327 (≠ Q328)
- binding magnesium ion: D194 (= D199), E220 (= E226), E247 (= E252)
Sites not aligning to the query:
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
30% identity, 97% coverage: 4:367/374 of query aligns to 4:370/373 of 3sjnA
- active site: S46 (≠ A54), L49 (≠ E57), T139 (≠ Y142), K165 (= K168), G167 (≠ K170), M171 (≠ W174), D198 (= D199), A200 (≠ N201), E225 (= E226), I247 (≠ V248), G250 (≠ A251), E251 (= E252), S252 (≠ I253), Q272 (= Q273), D274 (= D275), H301 (= H302), G302 (≠ W303), F303 (= F304), M325 (≠ V321), E326 (= E322), Q329 (≠ W325), S331 (≠ D327)
- binding magnesium ion: D198 (= D199), E225 (= E226), E251 (= E252)
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
32% identity, 98% coverage: 2:367/374 of query aligns to 3:360/367 of 5xd8B
- active site: S22 (= S23), T53 (≠ V51), G140 (≠ S139), K167 (= K168), K169 (= K170), D198 (= D199), N200 (= N201), E224 (= E226), G249 (≠ A251), E250 (= E252), Q271 (= Q273), D273 (= D275), H300 (= H302), G301 (≠ W303), M302 (≠ F304), W317 (≠ F324), E319 (≠ D326), P324 (≠ N331)
- binding magnesium ion: D198 (= D199), E224 (= E226), E250 (= E252)
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
31% identity, 89% coverage: 36:367/374 of query aligns to 47:382/386 of 3sqsA
- active site: L62 (≠ V51), N65 (≠ E57), S147 (= S139), K173 (= K165), R175 (≠ V167), G177 (≠ M169), G179 (≠ T171), K181 (≠ R173), A185 (= A177), E210 (≠ D199), Y212 (≠ N201), E236 (= E226), G261 (≠ A251), E262 (= E252), H263 (≠ I253), Q283 (= Q273), D285 (= D275), I307 (= I297), H312 (= H302), G314 (vs. gap), E332 (= E322), F337 (≠ W325)
- binding magnesium ion: E210 (≠ D199), E236 (= E226), E262 (= E252), Y347 (≠ R333), F350 (≠ V336), D351 (= D337)
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
31% identity, 80% coverage: 4:302/374 of query aligns to 3:305/372 of 4h19A
- active site: I20 (≠ L22), T51 (vs. gap), T143 (≠ S139), K172 (= K168), K174 (= K170), D203 (= D199), N205 (= N201), E229 (= E226), G254 (≠ A251), E255 (= E252), Q276 (= Q273), D278 (= D275), H305 (= H302)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: D22 (≠ N24), H25 (≠ V27), H52 (≠ Y50), K172 (= K168), K174 (= K170), D203 (= D199), N205 (= N201), E229 (= E226), E255 (= E252), H305 (= H302)
- binding calcium ion: D268 (= D265), H298 (≠ Y295)
- binding magnesium ion: D203 (= D199), E229 (= E226), E255 (= E252)
Sites not aligning to the query:
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
33% identity, 89% coverage: 28:360/374 of query aligns to 30:365/381 of 3ozmD
- active site: G53 (= G52), D56 (≠ A55), S143 (= S139), K170 (= K168), K172 (= K170), D200 (= D199), N202 (= N201), E226 (= E226), G252 (≠ A251), E253 (= E252), N254 (≠ I253), Q274 (= Q273), D276 (= D275), H303 (= H302), T304 (≠ W303), F305 (= F304), E328 (≠ F324), I331 (≠ D327), H333 (≠ V329)
- binding L-arabinaric acid: K172 (= K170), D200 (= D199), N202 (= N201), E253 (= E252), H303 (= H302), F305 (= F304), E328 (≠ F324)
- binding magnesium ion: D200 (= D199), E226 (= E226), E253 (= E252)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
33% identity, 90% coverage: 30:367/374 of query aligns to 29:373/378 of 4hpnA
- active site: G50 (= G52), R53 (≠ A55), T134 (≠ S139), K164 (= K168), K166 (= K170), D194 (= D199), N196 (= N201), E220 (= E226), G245 (≠ A251), E246 (= E252), T247 (≠ I253), Q267 (= Q273), D269 (= D275), H296 (= H302), V297 (vs. gap), W298 (= W303), R320 (≠ Y320), E329 (vs. gap), F330 (≠ W325), H334 (≠ V329)
- binding calcium ion: D194 (= D199), D209 (≠ R215), E220 (= E226), G237 (≠ L243), E246 (= E252)
Sites not aligning to the query:
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
33% identity, 89% coverage: 28:360/374 of query aligns to 30:365/386 of 3ozmA
- active site: G53 (= G52), D56 (≠ A55), S143 (= S139), K170 (= K168), K172 (= K170), D200 (= D199), N202 (= N201), E226 (= E226), G252 (≠ A251), E253 (= E252), N254 (≠ I253), Q274 (= Q273), D276 (= D275), H303 (= H302), T304 (≠ W303), F305 (= F304), E328 (≠ F324), I331 (≠ D327), H333 (≠ V329)
- binding D-xylaric acid: Y146 (= Y142), K170 (= K168), K172 (= K170), D200 (= D199), N202 (= N201), E253 (= E252), H303 (= H302), F305 (= F304), E328 (≠ F324)
- binding magnesium ion: D200 (= D199), E226 (= E226), E253 (= E252)
Sites not aligning to the query:
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
33% identity, 89% coverage: 28:360/374 of query aligns to 30:360/375 of 3op2A
- active site: G53 (= G52), D56 (≠ A55), S138 (= S139), K165 (= K168), K167 (= K170), D195 (= D199), N197 (= N201), E221 (= E226), G247 (≠ A251), E248 (= E252), N249 (≠ I253), Q269 (= Q273), D271 (= D275), H298 (= H302), T299 (≠ W303), F300 (= F304), E323 (≠ F324), I326 (≠ D327), H328 (≠ V329)
- binding 2-oxoglutaric acid: K165 (= K168), K167 (= K170), D195 (= D199), E248 (= E252), H298 (= H302), E323 (≠ F324)
- binding magnesium ion: D195 (= D199), E221 (= E226), E248 (= E252)
Sites not aligning to the query:
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
31% identity, 85% coverage: 4:322/374 of query aligns to 2:317/357 of 3ck5A
- active site: T19 (= T20), T50 (≠ V51), G137 (= G140), K164 (= K168), K166 (= K170), D195 (= D199), N197 (= N201), I220 (= I225), E221 (= E226), I243 (≠ V248), G246 (≠ A251), E247 (= E252), E268 (≠ Q273), D270 (= D275), H297 (= H302), G298 (≠ W303), V299 (≠ F304), Y315 (= Y320), E317 (= E322)
- binding magnesium ion: D195 (= D199), E221 (= E226), E247 (= E252)
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
31% identity, 85% coverage: 4:322/374 of query aligns to 2:317/361 of Q9RKF7
- D195 (= D199) binding
- E221 (= E226) binding
- E247 (= E252) binding
3stpA Crystal structure of a putative galactonate dehydratase
30% identity, 89% coverage: 36:367/374 of query aligns to 51:386/390 of 3stpA
- active site: L66 (≠ V51), S69 (≠ E57), S151 (= S139), K177 (= K168), R179 (≠ K170), P189 (≠ E180), E214 (≠ D199), Y216 (≠ N201), E240 (= E226), G265 (≠ A251), E266 (= E252), H267 (≠ I253), Q287 (= Q273), D289 (= D275), I311 (= I297), H316 (= H302), E336 (= E322), F341 (≠ W325)
- binding magnesium ion: E214 (≠ D199), E240 (= E226), E266 (= E252)
3ekgA Crystal structure of l-rhamnonate dehydratase from azotobacter vinelandii complexed with mg and l-tartrate
31% identity, 87% coverage: 34:360/374 of query aligns to 61:384/395 of 3ekgA
- active site: K178 (= K168), P180 (≠ K170), G184 (≠ W174), S186 (≠ P176), E190 (= E180), D215 (= D199), W217 (= W204), E241 (= E226), T266 (≠ A249), G268 (≠ A251), E269 (= E252), Q290 (= Q273), D292 (= D275), H319 (= H302), E339 (= E322), D348 (= D326)
- binding magnesium ion: D215 (= D199), E241 (= E226), E269 (= E252)
4h83F Crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127)
29% identity, 98% coverage: 3:367/374 of query aligns to 3:365/368 of 4h83F
- active site: F20 (≠ T20), D51 (≠ N53), I139 (≠ S139), K166 (= K168), K168 (= K170), I196 (≠ L198), D197 (= D199), A198 (≠ C200), N199 (= N201), E223 (= E226), G249 (≠ A251), Q250 (≠ E252), N271 (≠ Q273), D273 (= D275), H300 (= H302), E301 (≠ W303), E302 (≠ F304), E320 (= E322), D325 (= D327)
- binding bicarbonate ion: R220 (≠ Y223), I318 (≠ Y320)
Query Sequence
>H281DRAFT_06497 FitnessBrowser__Burk376:H281DRAFT_06497
MATIHSIEVCVARVPLDKVTYLSNRTVVDRHYGLVKVRSSDGAEGIGFCYVGNAAGEIFR
VAVEQLLAPVLNGRDSLEVEGLWKEMYQESLLQGRMGTVMRALSALDIALWDLNARTAGL
PLHKYLGAVELDHVDAYASGGYYVDGKTAEEVGEEMASYVALGFKAVKMKTGRWSPAGEE
SRVKAAREAIGPDVELMLDCNNGWVDTVQAMQYLRRFEQYDPYFIEEPFSPDDIESHARL
AKLTRIPVATAEIGYGRWYHKQLLDMGGASILQTDAAVCGGITEWRRIAAMASGYGIQMC
PHWFHDVHAPLVAATQNARYVEFFWDDQVLNFRRLVDRQLTHKEGRVLLHQTPGLGFNFD
EAEVARYGRWTKVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory