Comparing H281DRAFT_06498 FitnessBrowser__Burk376:H281DRAFT_06498 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3nojA The structure of hmg/cha aldolase from the protocatechuate degradation pathway of pseudomonas putida (see paper)
33% identity, 89% coverage: 6:206/227 of query aligns to 10:210/235 of 3nojA
A5W059 4-hydroxy-4-methyl-2-oxoglutarate aldolase/4-carboxy-4-hydroxy-2-oxoadipate aldolase; HMG/CHA aldolase; Oxaloacetate decarboxylase; OAA decarboxylase; EC 4.1.3.17; EC 4.1.1.112 from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) (see paper)
33% identity, 89% coverage: 6:206/227 of query aligns to 11:211/238 of A5W059
1nxjA Structure of rv3853 from mycobacterium tuberculosis (see paper)
36% identity, 59% coverage: 42:175/227 of query aligns to 24:156/156 of 1nxjA
2yjvC Crystal structure of e. Coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb (see paper)
31% identity, 56% coverage: 49:176/227 of query aligns to 28:154/158 of 2yjvC
>H281DRAFT_06498 FitnessBrowser__Burk376:H281DRAFT_06498
MSKPNIVKDFERVSPELVKKASQFQPAILSDVNGRRGALHGRIKALYPRMKLAGPAFTVE
VRPGDNLMIHAALAVAKPGDVLVIDGKADQTCALMGTIMMHAARERGLAGVVLDAAVRDS
LDLDELDFPVFSVGTNPNGPTKEVGGRIGHPIACGGVTVNPGDFIIADADGVMCVEREKL
ESLLDKASEKVAWEARRIADIKEGKLNPPYLTQALITAGVIKEGETL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory