Comparing H281DRAFT_06499 FitnessBrowser__Burk376:H281DRAFT_06499 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 97% coverage: 8:305/306 of query aligns to 3:303/304 of 1wwkA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 37:291/301 of 6rj5A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 34:288/299 of 6rj2A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 36:290/297 of 6rj3A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 37:291/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 38:292/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 37:291/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 37:291/302 of 6rihA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 36:290/299 of 6cwaA
7dkmA Phgdh covalently linked to oridonin (see paper)
36% identity, 82% coverage: 42:293/306 of query aligns to 38:292/306 of 7dkmA
Sites not aligning to the query:
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
36% identity, 82% coverage: 42:293/306 of query aligns to 42:296/533 of O43175
Sites not aligning to the query:
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 76% coverage: 62:293/306 of query aligns to 49:282/292 of 6plfB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
35% identity, 98% coverage: 5:304/306 of query aligns to 2:301/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
35% identity, 98% coverage: 5:304/306 of query aligns to 3:302/525 of 3ddnB
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
34% identity, 79% coverage: 62:302/306 of query aligns to 61:310/334 of 5aovA
Sites not aligning to the query:
7cvpA The crystal structure of human phgdh from biortus.
37% identity, 63% coverage: 101:293/306 of query aligns to 51:245/254 of 7cvpA
7va1A Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35
38% identity, 61% coverage: 101:288/306 of query aligns to 1:190/193 of 7va1A
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
38% identity, 61% coverage: 101:288/306 of query aligns to 3:192/195 of 5ofwA
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
38% identity, 61% coverage: 101:288/306 of query aligns to 3:192/195 of 5ofvA
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
38% identity, 61% coverage: 101:288/306 of query aligns to 3:192/195 of 5ofmA
>H281DRAFT_06499 FitnessBrowser__Burk376:H281DRAFT_06499
VSAKPVILVTGADLAPQAVALLADYEIVYAGATPGPDELLRLARQHNPTAIIVRFGGVTP
VIMDAAPALKVISKHGSGTDTIDKQAAAERNIKVVAAVGSNAAAVAEQALALTLACAKSV
VKLHERMQAGHWDKATHKNVELNGKTIGLIGLGAIGRKFARMVEALDMRVLGFDPYAKDL
PHYIQPVDLGTIWRESNVLSFHCPLTADNRNMLNAQTLAQCKKGVIVVNTARGGLIEEPA
LLAAVQSGQVAMAGLDSFAIEPLAVPHMFRNQERIILSPHIGGTTSDAVVSMGVAAARNI
LAAMND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory