SitesBLAST
Comparing H281DRAFT_06500 FitnessBrowser__Burk376:H281DRAFT_06500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
45% identity, 92% coverage: 26:307/308 of query aligns to 28:312/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
45% identity, 92% coverage: 26:307/308 of query aligns to 26:310/311 of 3bazA
- active site: L98 (= L96), R230 (= R227), A251 (= A248), D254 (= D251), E259 (= E256), H277 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V72), G149 (= G147), L150 (= L148), G151 (= G149), R152 (= R150), I153 (= I151), S172 (≠ G170), R173 (vs. gap), S174 (= S171), C201 (= C198), P202 (= P199), T207 (= T204), I228 (≠ V225), G229 (≠ S226), R230 (= R227), D254 (= D251), H277 (= H274), G279 (= G276)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
46% identity, 84% coverage: 50:307/308 of query aligns to 48:308/317 of 5v7gA
- active site: L94 (= L96), R228 (= R227), D252 (= D251), E257 (= E256), H275 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V72), V98 (= V100), F146 (≠ V146), L148 (= L148), G149 (= G149), R150 (= R150), I151 (= I151), T170 (≠ C169), R171 (≠ G170), V199 (≠ C198), P200 (= P199), S204 (≠ R203), T205 (= T204), V226 (= V225), G227 (≠ S226), R228 (= R227), H275 (= H274), A277 (≠ G276)
- binding oxalate ion: G69 (= G71), V70 (= V72), G71 (= G73), R228 (= R227), H275 (= H274)
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
46% identity, 84% coverage: 50:307/308 of query aligns to 50:310/319 of 5v6qB
- active site: L96 (= L96), R230 (= R227), D254 (= D251), E259 (= E256), H277 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V72), V100 (= V100), F148 (≠ V146), L150 (= L148), G151 (= G149), R152 (= R150), I153 (= I151), T172 (≠ C169), R173 (≠ G170), V201 (≠ C198), P202 (= P199), S206 (≠ R203), T207 (= T204), V228 (= V225), G229 (≠ S226), R230 (= R227), H277 (= H274), A279 (≠ G276)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
46% identity, 84% coverage: 50:307/308 of query aligns to 48:308/318 of 5j23A
- active site: L94 (= L96), R228 (= R227), D252 (= D251), E257 (= E256), H275 (= H274)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V72), L148 (= L148), G149 (= G149), R150 (= R150), I151 (= I151), T170 (≠ C169), R171 (≠ G170), P200 (= P199), S204 (≠ R203), T205 (= T204), R228 (= R227)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
46% identity, 84% coverage: 50:307/308 of query aligns to 49:309/319 of 5v7nA
- active site: L95 (= L96), R229 (= R227), D253 (= D251), E258 (= E256), H276 (= H274)
- binding 2-keto-D-gluconic acid: G70 (= G71), V71 (= V72), G72 (= G73), R229 (= R227), H276 (= H274), S279 (= S277), R285 (= R283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V72), V99 (= V100), L149 (= L148), G150 (= G149), R151 (= R150), I152 (= I151), T171 (≠ C169), R172 (≠ G170), V200 (≠ C198), P201 (= P199), S205 (≠ R203), T206 (= T204), V227 (= V225), G228 (≠ S226), R229 (= R227), H276 (= H274), A278 (≠ G276)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
41% identity, 82% coverage: 42:294/308 of query aligns to 46:308/334 of 5aovA
- active site: L100 (= L96), R241 (= R227), D265 (= D251), E270 (= E256), H288 (= H274)
- binding glyoxylic acid: M52 (≠ R48), L53 (≠ S49), L53 (≠ S49), Y74 (≠ S70), A75 (≠ G71), V76 (= V72), G77 (= G73), R241 (= R227), H288 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V72), T104 (≠ V100), F158 (≠ L148), G159 (= G149), R160 (= R150), I161 (= I151), S180 (≠ G170), R181 (vs. gap), A211 (≠ C197), V212 (≠ C198), P213 (= P199), T218 (= T204), I239 (≠ V225), A240 (≠ S226), R241 (= R227), H288 (= H274), G290 (= G276)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
39% identity, 86% coverage: 42:307/308 of query aligns to 45:320/332 of 6biiA
- active site: L99 (= L96), R240 (= R227), D264 (= D251), E269 (= E256), H287 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V72), T103 (≠ V100), G156 (= G147), F157 (≠ L148), G158 (= G149), R159 (= R150), I160 (= I151), A179 (≠ G170), R180 (≠ S171), S181 (vs. gap), K183 (vs. gap), V211 (≠ C198), P212 (= P199), E216 (≠ R203), T217 (= T204), V238 (= V225), A239 (≠ S226), R240 (= R227), D264 (= D251), H287 (= H274), G289 (= G276)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
40% identity, 82% coverage: 42:294/308 of query aligns to 46:308/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
40% identity, 82% coverage: 42:294/308 of query aligns to 46:308/333 of 2dbqA
- active site: L100 (= L96), R241 (= R227), D265 (= D251), E270 (= E256), H288 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V72), T104 (≠ V100), L158 (= L148), G159 (= G149), R160 (= R150), I161 (= I151), S180 (≠ G170), R181 (vs. gap), T182 (vs. gap), A211 (≠ C197), V212 (≠ C198), P213 (= P199), T218 (= T204), I239 (≠ V225), A240 (≠ S226), R241 (= R227), D265 (= D251), H288 (= H274), G290 (= G276)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
39% identity, 85% coverage: 23:283/308 of query aligns to 24:287/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
40% identity, 85% coverage: 23:283/308 of query aligns to 23:286/526 of 3dc2A
Sites not aligning to the query:
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
38% identity, 86% coverage: 30:294/308 of query aligns to 39:309/324 of 2gcgA
- active site: L103 (= L96), R241 (= R227), D265 (= D251), E270 (= E256), H289 (= H274)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (= L46), S78 (≠ G71), V79 (= V72), G80 (= G73), R241 (= R227), H289 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V72), T107 (≠ V100), G156 (= G147), G158 (= G149), I160 (= I151), G180 (= G170), R181 (≠ S171), R184 (vs. gap), C212 (= C198), S213 (≠ P199), T218 (= T204), I239 (≠ V225), R241 (= R227), D265 (= D251), H289 (= H274), G291 (= G276)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
38% identity, 86% coverage: 30:294/308 of query aligns to 43:313/328 of Q9UBQ7
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
34% identity, 90% coverage: 25:300/308 of query aligns to 27:304/304 of 1wwkA
- active site: S96 (≠ L96), R230 (= R227), D254 (= D251), E259 (= E256), H278 (= H274)
- binding nicotinamide-adenine-dinucleotide: V100 (= V100), G146 (= G140), F147 (≠ K141), G148 (≠ R142), R149 (≠ I143), I150 (≠ G144), Y168 (≠ F162), D169 (= D163), P170 (≠ A167), V201 (≠ C198), P202 (= P199), T207 (= T204), T228 (≠ V225), S229 (= S226), D254 (= D251), H278 (= H274), G280 (= G276)
2w2lA Crystal structure of the holo forms of rhodotorula graminis d- mandelate dehydrogenase at 2.5a.
33% identity, 99% coverage: 1:306/308 of query aligns to 1:337/346 of 2w2lA
- active site: G113 (≠ L96), R257 (= R227), D281 (= D251), E286 (= E256), H304 (= H274)
- binding nicotinamide-adenine-dinucleotide: T117 (≠ V100), G172 (= G149), A173 (≠ R150), I174 (= I151), D194 (vs. gap), V228 (≠ C198), P229 (= P199), T234 (= T204), T255 (≠ V225), A256 (≠ S226), R257 (= R227), H304 (= H274), G306 (= G276), G307 (≠ S277)
7dkmA Phgdh covalently linked to oridonin (see paper)
30% identity, 88% coverage: 13:283/308 of query aligns to 13:288/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V72), A102 (≠ V100), G148 (= G147), R151 (= R150), I152 (= I151), Y170 (= Y168), D171 (vs. gap), P172 (vs. gap), I173 (vs. gap), H202 (≠ C197), T203 (≠ C198), P204 (= P199), T209 (= T204), C230 (≠ V225), A231 (≠ S226), R232 (= R227), H279 (= H274), G281 (= G276)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ S14), K17 (≠ Q17), I18 (≠ D18)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 293
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
30% identity, 88% coverage: 13:283/308 of query aligns to 11:286/297 of 6rj3A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
30% identity, 88% coverage: 13:283/308 of query aligns to 9:284/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G149), I148 (= I151), Y166 (= Y168), D167 (vs. gap), P168 (vs. gap), I169 (vs. gap), I170 (vs. gap), H198 (≠ C197), T199 (≠ C198), L208 (= L207), R228 (= R227)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
30% identity, 88% coverage: 13:283/308 of query aligns to 11:286/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ L96), A100 (≠ V100), R149 (= R150), I150 (= I151), Y168 (= Y168), D169 (vs. gap), P170 (vs. gap), I171 (vs. gap), H200 (≠ C197), T201 (≠ C198), P202 (= P199), T207 (= T204), C228 (≠ V225), A229 (≠ S226), R230 (= R227), H277 (= H274), G279 (= G276)
Query Sequence
>H281DRAFT_06500 FitnessBrowser__Burk376:H281DRAFT_06500
MPRPNVLQIGEFPSAQQDIINAEVRRYAQEDLQRDPAVSEGIEAILTRSSYQVPASLLAS
LPNLKIIATSGVGFDGIPLDAARSRGVIVTNTPGVLDAAVCELAIGLLLSLLRRIPSADR
FVRDEAWAHELFPLTSSLAGKRIGIVGLGRIGQGIARRLAGFDVEIAYCGSKVEGLPYAM
ISDVRELASFADILIVCCPGGDRTRHLIDGAVLSALGSSGFLVNVSRGTVVDEAALIDAL
EKGLIRGAALDVFEKEPLIGSRLATLSNVVLTPHAGSATEETRHTMLRLALDNIHRVLDG
SCALTPVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory