SitesBLAST
Comparing H281DRAFT_06507 FitnessBrowser__Burk376:H281DRAFT_06507 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
55% identity, 100% coverage: 1:249/249 of query aligns to 1:249/249 of 4bmsF
- active site: S137 (= S137), H147 (≠ F147), Y150 (= Y150), K154 (= K154), Q195 (≠ E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (= N15), S16 (= S16), I18 (≠ M18), R38 (= R38), R39 (= R39), A59 (≠ G59), D60 (= D60), V61 (= V61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (= V110), S137 (= S137), Y150 (= Y150), K154 (= K154), G181 (= G181), I183 (= I183), T185 (= T185), I187 (= I187)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
55% identity, 100% coverage: 1:249/249 of query aligns to 1:249/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S137), H147 (≠ F147), Y150 (= Y150), L188 (≠ F188), L246 (≠ M246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (= N15), S16 (= S16), G17 (= G17), I18 (≠ M18), R38 (= R38), R39 (= R39), D60 (= D60), V61 (= V61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (= V110), T135 (≠ N135), S137 (= S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), A182 (≠ P182), I183 (= I183), T185 (= T185), S187 (≠ I187)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
42% identity, 98% coverage: 6:248/249 of query aligns to 5:246/251 of 4esoB
- active site: G16 (= G17), S136 (= S137), M146 (≠ F147), Y149 (= Y150), K153 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), T14 (≠ N15), H15 (≠ S16), M17 (= M18), R37 (= R38), N38 (≠ R39), N41 (≠ E42), S58 (≠ G59), D59 (= D60), I60 (≠ V61), N86 (= N87), A87 (= A88), G88 (= G89), T134 (≠ N135), S136 (= S137), Y149 (= Y150), P179 (= P180), G180 (= G181), I182 (= I183), T184 (= T185), T186 (≠ I187), K187 (≠ F188), G188 (= G189)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 99% coverage: 1:246/249 of query aligns to 6:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ N15), K21 (≠ S16), G22 (= G17), I23 (≠ M18), A43 (≠ R38), S44 (≠ R39), S45 (≠ Q40), G68 (= G59), D69 (= D60), V70 (= V61), N96 (= N87), S97 (≠ A88), G98 (= G89), Y100 (≠ G91), I144 (≠ N135), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (= G181), M191 (≠ P182), I192 (= I183), T194 (= T185), G196 (≠ I187), T197 (≠ F188)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S137), Y159 (= Y150), M191 (≠ P182), I202 (≠ L193)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
42% identity, 98% coverage: 3:245/249 of query aligns to 3:237/241 of 5t2uA
- active site: G17 (= G17), T135 (≠ S137), T145 (≠ F147), Y148 (= Y150), K152 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), G17 (= G17), R38 (= R38), D39 (≠ R39), R42 (≠ E42), D60 (= D60), L61 (= L64), N83 (= N87), A84 (= A88), Y87 (≠ G91), I133 (≠ N135), T135 (≠ S137), Y148 (= Y150), K152 (= K154), P178 (= P180), P180 (= P182), T181 (≠ I183), T183 (= T185), T185 (≠ I187), T186 (= T194)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 99% coverage: 1:246/249 of query aligns to 2:242/244 of 4nbuB
- active site: G18 (= G17), N111 (= N111), S139 (= S137), Q149 (≠ F147), Y152 (= Y150), K156 (= K154)
- binding acetoacetyl-coenzyme a: D93 (≠ L93), K98 (≠ Q98), S139 (= S137), N146 (≠ M144), V147 (≠ E145), Q149 (≠ F147), Y152 (= Y150), F184 (≠ P182), M189 (≠ I187), K200 (≠ G200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (≠ M18), D38 (≠ G37), F39 (≠ R38), V59 (≠ G59), D60 (= D60), V61 (= V61), N87 (= N87), A88 (= A88), G89 (= G89), I90 (≠ L90), T137 (≠ N135), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), F184 (≠ P182), T185 (≠ I183), T187 (= T185), M189 (≠ I187)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
33% identity, 98% coverage: 3:247/249 of query aligns to 5:259/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S137), N144 (≠ I138), T145 (≠ A139), F153 (= F147), Y156 (= Y150), G187 (= G181), M193 (≠ I187), V197 (vs. gap), A259 (= A247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ S16), I20 (≠ M18), A40 (vs. gap), N41 (vs. gap), S42 (vs. gap), D66 (= D60), N93 (= N87), S94 (≠ A88), L116 (≠ V110), T141 (≠ N135), Y156 (= Y150), K160 (= K154), P186 (= P180), G187 (= G181), G188 (≠ P182), T189 (≠ I183), T191 (= T185), M193 (≠ I187)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
37% identity, 98% coverage: 1:245/249 of query aligns to 5:250/262 of 3pk0B
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
40% identity, 98% coverage: 3:246/249 of query aligns to 2:237/239 of 4nbtA
- active site: G16 (= G17), S132 (= S137), Y145 (= Y150), K149 (= K154)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), K15 (≠ S16), G16 (= G17), L17 (≠ M18), D36 (≠ E42), L37 (= L43), L52 (≠ G59), N53 (≠ D60), V54 (= V61), N80 (= N87), A81 (= A88), G82 (= G89), I130 (≠ N135), S132 (= S137), Y145 (= Y150), K149 (= K154), P177 (= P180), G178 (= G181), I180 (= I183), T182 (= T185)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
33% identity, 98% coverage: 3:247/249 of query aligns to 5:260/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ I138), T145 (≠ A139), F154 (= F147), G189 (≠ P182), V198 (vs. gap), A260 (= A247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ S16), I20 (≠ M18), Y39 (vs. gap), A40 (vs. gap), N41 (vs. gap), S42 (vs. gap), D66 (= D60), V67 (= V61), N93 (= N87), S94 (≠ A88), L116 (≠ V110), T141 (≠ N135), Y157 (= Y150), K161 (= K154), P187 (= P180), T190 (≠ I183), T192 (= T185), M194 (≠ I187)
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
37% identity, 98% coverage: 2:245/249 of query aligns to 1:249/254 of 3toxA
- active site: G16 (= G17), S142 (= S137), V153 (≠ F147), Y156 (= Y150), K160 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ N15), S15 (= S16), G16 (= G17), I17 (≠ M18), A36 (≠ G37), R37 (= R38), N38 (≠ R39), V63 (= V61), N89 (= N87), A90 (= A88), G91 (= G89), T140 (≠ N135), S142 (= S137), Y156 (= Y150), K160 (= K154), P186 (= P180), G188 (≠ P182), T189 (≠ I183), T191 (= T185)
Q9S9W2 Short-chain dehydrogenase/reductase SDRA; Protein INDOLE-3-BUTYRIC ACID RESPONSE 1; Short-chain dehydrogenase/reductase A; EC 1.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 98% coverage: 3:246/249 of query aligns to 8:250/254 of Q9S9W2
- R43 (= R38) mutation to C: In ibr1-1; resistance to the inhibitory effect of intermediate levels of indole-3-butyric acid (IBA) on root elongation.
- S140 (= S131) mutation to F: In ibr1-8; resistance to the inhibitory effect of intermediate levels of indole-3-butyric acid (IBA) on root elongation.
Q12634 Tetrahydroxynaphthalene reductase; T4HN reductase; THNR; EC 1.1.1.252 from Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae) (see 2 papers)
30% identity, 97% coverage: 4:245/249 of query aligns to 27:280/283 of Q12634
- 39:63 (vs. 16:40, 28% identical) binding
- Y178 (= Y150) active site, Proton acceptor
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
30% identity, 97% coverage: 4:245/249 of query aligns to 17:270/273 of 1g0nA
- active site: G30 (= G17), S154 (= S137), H165 (≠ F147), Y168 (= Y150), K172 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (≠ S16), G30 (= G17), I31 (≠ M18), A51 (≠ R38), N52 (≠ R39), S53 (≠ Q40), V78 (= V61), N104 (= N87), S105 (≠ A88), G106 (= G89), I127 (≠ V110), M152 (≠ N135), Y168 (= Y150), K172 (= K154), P198 (= P180), G200 (≠ P182), I201 (= I183), T203 (= T185), M205 (≠ I187)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (= S137), Y168 (= Y150), G200 (≠ P182), M205 (≠ I187), Y206 (≠ F188), C210 (vs. gap), Y213 (vs. gap), W233 (≠ Q208)
1dohA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4-nitro-inden-1-one (see paper)
30% identity, 97% coverage: 4:245/249 of query aligns to 17:270/273 of 1dohA
- active site: G30 (= G17), S154 (= S137), H165 (≠ F147), Y168 (= Y150), K172 (= K154), Y213 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (≠ S16), G30 (= G17), I31 (≠ M18), A51 (≠ R38), N52 (≠ R39), S53 (≠ Q40), N77 (≠ D60), V78 (= V61), N104 (= N87), S105 (≠ A88), G106 (= G89), M152 (≠ N135), Y168 (= Y150), K172 (= K154), P198 (= P180), G200 (≠ P182), I201 (= I183), T203 (= T185), M205 (≠ I187)
- binding 4-nitro-inden-1-one: Y168 (= Y150), G200 (≠ P182), Y206 (≠ F188), C210 (vs. gap), Y213 (vs. gap)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
30% identity, 97% coverage: 4:245/249 of query aligns to 14:267/270 of 1ybvA
- active site: G27 (= G17), S151 (= S137), H162 (≠ F147), Y165 (= Y150), K169 (= K154), Y210 (vs. gap)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (= S137), Y165 (= Y150), G197 (≠ P182), M202 (≠ I187), Y203 (≠ F188), Y210 (vs. gap), W230 (≠ Q208)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G13), R26 (≠ S16), G27 (= G17), I28 (≠ M18), A48 (≠ R38), N49 (≠ R39), S50 (≠ Q40), N74 (≠ D60), V75 (= V61), N101 (= N87), S102 (≠ A88), G103 (= G89), M149 (≠ N135), S151 (= S137), K169 (= K154), P195 (= P180), G197 (≠ P182), I198 (= I183), T200 (= T185), M202 (≠ I187)
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
33% identity, 98% coverage: 3:246/249 of query aligns to 7:256/260 of 5ojiA
- active site: G21 (= G17), S148 (= S137), Y161 (= Y150), K165 (= K154)
- binding isatin: S148 (= S137), S150 (≠ A139), Y161 (= Y150), V193 (≠ P182), S199 (≠ F188), L202 (≠ T191)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G13), T19 (≠ N15), I22 (≠ M18), S41 (≠ G37), R42 (= R38), N43 (≠ R39), N46 (≠ E42), I69 (≠ V61), N95 (= N87), H96 (≠ A88), G97 (= G89), N146 (= N135), S148 (= S137), Y161 (= Y150), K165 (= K154), G192 (= G181), I194 (= I183), T196 (= T185), M198 (≠ I187)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
33% identity, 98% coverage: 3:246/249 of query aligns to 7:256/260 of 5ojgA
- active site: G21 (= G17), S148 (= S137), Y161 (= Y150), K165 (= K154)
- binding butane-2,3-dione: S148 (= S137), Y161 (= Y150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G13), T19 (≠ N15), G21 (= G17), I22 (≠ M18), S41 (≠ G37), R42 (= R38), N43 (≠ R39), N46 (≠ E42), I69 (≠ V61), N95 (= N87), H96 (≠ A88), G97 (= G89), N146 (= N135), S148 (= S137), Y161 (= Y150), K165 (= K154), P191 (= P180), I194 (= I183), T196 (= T185), M198 (≠ I187)
1g0oC Structure of trihydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
30% identity, 97% coverage: 4:245/249 of query aligns to 25:278/281 of 1g0oC
- active site: G38 (= G17), S162 (= S137), H173 (≠ F147), Y176 (= Y150), K180 (= K154), Y221 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G34 (= G13), R37 (≠ S16), G38 (= G17), I39 (≠ M18), A59 (≠ R38), N60 (≠ R39), S61 (≠ Q40), N85 (≠ D60), V86 (= V61), N112 (= N87), S113 (≠ A88), G114 (= G89), M160 (≠ N135), Y176 (= Y150), K180 (= K154), P206 (= P180), G208 (≠ P182), I209 (= I183), T211 (= T185), M213 (≠ I187)
- binding pyroquilon: S162 (= S137), I163 (= I138), Y176 (= Y150), G208 (≠ P182), Y221 (vs. gap)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
33% identity, 98% coverage: 4:246/249 of query aligns to 3:241/244 of 7krmC
- active site: G18 (= G17), S140 (= S137), Y155 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G18 (= G17), I19 (≠ M18), D38 (≠ G37), L39 (≠ R38), A60 (≠ G59), N61 (≠ D60), V62 (= V61), N88 (= N87), V111 (= V110), S140 (= S137), Y155 (= Y150), K159 (= K154), I188 (= I183), T190 (= T185)
Query Sequence
>H281DRAFT_06507 FitnessBrowser__Burk376:H281DRAFT_06507
MTKLSGKIAVITGGNSGMGLATAQLFAKEGAKVIITGRRQKELDEAVESIGANAEGVLGD
VSRLSDLDKLNDHVKAKYGRVDVIFANAGLGSLAPIDQVTEAQFDETFNVNVKGTYFTVQ
KLLPLVPDGGSIILNTSIASSKGMEAFSVYSATKAAVRSLARTLTTDLKARKIRVNAISP
GPIDTPIFGKTGLTEQEIEGFKSGITSQVPLGRIGLPEEIAKPALFLASDDSSYISGIEL
TVDGGMAQV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory