Comparing H281DRAFT_06512 FitnessBrowser__Burk376:H281DRAFT_06512 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 95% coverage: 12:393/403 of query aligns to 4:378/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 92% coverage: 21:391/403 of query aligns to 51:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 93% coverage: 18:391/403 of query aligns to 51:427/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
35% identity, 89% coverage: 10:369/403 of query aligns to 11:374/398 of 6slfA
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
29% identity, 95% coverage: 10:392/403 of query aligns to 8:389/389 of 4ewtA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
25% identity, 45% coverage: 113:295/403 of query aligns to 108:287/377 of 7t1qA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
22% identity, 75% coverage: 18:321/403 of query aligns to 18:311/391 of 3ramA
Sites not aligning to the query:
>H281DRAFT_06512 FitnessBrowser__Burk376:H281DRAFT_06512
LETTDIPETSLSAHHPHWAKLRRDLHAYPELRFEEHRTADVVARELEEFGYTVSRGLGGT
GVVASLPGVNPHWGIVLRADMDALPIQEANDFTHASCTHGIMHACGHDGHTVMLLGAARI
LRGMPQLPGSVHFVFQPGEEGGAGARKMIDDGLFVQYPTEAVFGMHNWPSLPGGHFGLRV
GPIMAAGSRFRITVTGKGAHAAQPHLGLDPIPLACSMVLHCQTIAARHKDPVDPAVISVC
MIHAGDTDNVIPDSAELRGTIRTLSSELQQKLQRDIQLMCEGLAAAHGAQVEVTFFQYYP
ATINTRAETQLCEAVIRETFGDERTHADVPANMTSEDFGFMLEERPGTYVLIGNAHVGET
APGLHNPKYDFNDDIIPAGVQYWITLAQQYFQTRQPERPVQKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory