SitesBLAST
Comparing H281DRAFT_06542 H281DRAFT_06542 4-methylaminobutanoate oxidase (formaldehyde-forming) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
40% identity, 99% coverage: 5:825/826 of query aligns to 22:823/824 of Q8GAI3
- W66 (= W49) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H50) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
34% identity, 97% coverage: 8:811/826 of query aligns to 42:835/857 of Q63342
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
34% identity, 97% coverage: 8:811/826 of query aligns to 5:798/824 of 4pabB
- active site: T53 (≠ G56), E102 (≠ Q105), H226 (= H238), Y255 (= Y264), E536 (≠ D543)
- binding flavin-adenine dinucleotide: I11 (= I14), G12 (= G15), G14 (= G17), C15 (≠ I18), V16 (≠ I19), L35 (= L38), E36 (= E39), K37 (≠ Q40), G43 (= G46), S44 (≠ T47), T45 (= T48), H47 (= H50), A48 (= A51), A49 (= A52), G50 (= G53), L51 (= L54), V175 (= V178), A204 (= A216), G205 (= G217), W207 (= W219), H226 (= H238), Y228 (= Y240), G326 (= G330), I328 (≠ E332), F353 (= F357), Y355 (≠ M360), G356 (= G361), I357 (= I362), I358 (≠ A363)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y530), E536 (≠ D543), T538 (= T545), I550 (≠ V557), F612 (= F618), L613 (≠ G619), Y632 (= Y638), E639 (= E645), F680 (≠ Y686), Y700 (≠ F706)
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
34% identity, 94% coverage: 8:781/826 of query aligns to 49:818/866 of Q9UI17
- CV 59:60 (≠ II 18:19) binding
- EK 80:81 (≠ EQ 39:40) binding
- 87:95 (vs. 46:54, 89% identical) binding
- H91 (= H50) modified: Tele-8alpha-FAD histidine
- H109 (≠ I68) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V178) binding
- S279 (≠ A247) to P: in dbSNP:rs532964
- F-GYGII 397:402 (≠ FNSMGIA 357:363) binding
- A530 (= A492) to G: in dbSNP:rs1805073
- S646 (≠ K608) to P: in dbSNP:rs1805074
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
31% identity, 99% coverage: 10:825/826 of query aligns to 4:827/828 of 1pj6A
- active site: H223 (= H238), Y257 (= Y264), D550 (= D543)
- binding flavin-adenine dinucleotide: G9 (= G15), G11 (= G17), I12 (= I18), V13 (≠ I19), D33 (≠ E39), Q34 (= Q40), G42 (= G46), S43 (≠ T47), T44 (= T48), H46 (= H50), P48 (≠ A52), L50 (= L54), V172 (= V178), A201 (= A216), G202 (= G217), W204 (= W219), H223 (= H238), Y257 (= Y264), G331 (= G330), I332 (≠ P331), V358 (≠ M360), W359 (≠ G361), V360 (≠ I362), T361 (≠ A363)
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
31% identity, 99% coverage: 10:825/826 of query aligns to 6:829/830 of Q9AGP8
- IV 14:15 (≠ II 18:19) binding
- DQ 35:36 (≠ EQ 39:40) binding
- STSH 45:48 (≠ TTWH 47:50) binding
- L52 (= L54) binding
- V174 (= V178) binding
- H225 (= H238) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (= Y264) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ MGIA 360:363) binding
- Y539 (= Y530) binding
- D552 (= D543) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
31% identity, 99% coverage: 10:825/826 of query aligns to 3:826/827 of 1pj7A
- active site: H222 (= H238), Y256 (= Y264), D549 (= D543)
- binding flavin-adenine dinucleotide: G8 (= G15), G10 (= G17), I11 (= I18), V12 (≠ I19), D32 (≠ E39), Q33 (= Q40), G41 (= G46), S42 (≠ T47), T43 (= T48), H45 (= H50), P47 (≠ A52), L49 (= L54), T170 (≠ R177), V171 (= V178), A200 (= A216), G201 (= G217), W203 (= W219), H222 (= H238), Y256 (= Y264), I331 (≠ P331), V357 (≠ M360), W358 (≠ G361), V359 (≠ I362), T360 (≠ A363)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (≠ F499), Y536 (= Y530), D549 (= D543), T551 (= T545), G563 (≠ V557), F629 (≠ G619), Y648 (= Y638), E655 (= E645), Y696 (= Y686)
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
30% identity, 99% coverage: 10:825/826 of query aligns to 3:826/827 of 3gsiA
- active site: H222 (= H238), Y256 (= Y264), A549 (≠ D543)
- binding flavin-adenine dinucleotide: G10 (= G17), I11 (= I18), V12 (≠ I19), D32 (≠ E39), Q33 (= Q40), G41 (= G46), S42 (≠ T47), T43 (= T48), H45 (= H50), P47 (≠ A52), L49 (= L54), T170 (≠ R177), V171 (= V178), A200 (= A216), G201 (= G217), W203 (= W219), H222 (= H238), Y256 (= Y264), G330 (= G330), I331 (≠ P331), F332 (≠ E332), V357 (≠ M360), W358 (≠ G361), V359 (≠ I362), T360 (≠ A363)
- binding magnesium ion: D254 (≠ F262), V409 (≠ G412)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (≠ F499), Y536 (= Y530), T551 (= T545), G563 (≠ V557), F629 (≠ G619), Y648 (= Y638), E655 (= E645), Y696 (= Y686)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 430:784/826 of query aligns to 1:329/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 430:784/826 of query aligns to 1:329/362 of 1wopA
- active site: D96 (= D543)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ F499), L55 (= L503), Y83 (= Y530), D96 (= D543), V98 (≠ T545), E106 (≠ Q553), L108 (= L555), V110 (= V557), N112 (≠ G559), I137 (≠ V585), E160 (≠ K608), Y168 (≠ F618), Y169 (≠ G619), K173 (≠ E623), S174 (≠ V624), I175 (≠ D625), E180 (≠ T630), T181 (≠ V631), Y188 (= Y638), E195 (= E645), M197 (≠ Y647), R227 (≠ I677), Y236 (= Y686)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
28% identity, 43% coverage: 430:784/826 of query aligns to 1:329/362 of 1wooA
- active site: D96 (= D543)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ F499), Y83 (= Y530), D96 (= D543), V98 (≠ T545), V110 (= V557), N112 (≠ G559), Y168 (≠ F618), Y169 (≠ G619), Y188 (= Y638), E195 (= E645), Y236 (= Y686)
Sites not aligning to the query:
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
26% identity, 47% coverage: 5:395/826 of query aligns to 1:370/374 of 1y56B
- active site: F44 (≠ W49), G47 (≠ A52), T48 (≠ G53), H224 (= H238), P239 (≠ L253), G305 (= G330), M338 (≠ A363)
- binding flavin-adenine dinucleotide: G11 (= G15), G13 (= G17), I14 (= I18), V15 (≠ I19), I33 (≠ L38), E34 (= E39), K35 (≠ Q40), S42 (≠ T47), T43 (= T48), R45 (≠ H50), C46 (≠ A51), G47 (≠ A52), G49 (≠ L54), E170 (≠ R177), V171 (= V178), T200 (≠ A216), N201 (≠ G217), W203 (= W219), G305 (= G330), Y306 (≠ P331), Y307 (≠ E332), G334 (≠ S359), H335 (≠ M360), G336 (= G361), F337 (≠ I362), M338 (≠ A363)
- binding flavin mononucleotide: F44 (≠ W49), R45 (≠ H50), I260 (≠ M274), R301 (≠ Q326), W303 (≠ Y328)
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
26% identity, 48% coverage: 429:823/826 of query aligns to 575:964/967 of Q46337
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 139 G→A: Does not affect activity and binding of NAD(+).
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
28% identity, 34% coverage: 425:704/826 of query aligns to 569:843/965 of 2gagA
Sites not aligning to the query:
- active site: 350, 375
- binding flavin mononucleotide: 510, 511, 517, 521, 549, 551
- binding 2-furoic acid: 851
- binding nicotinamide-adenine-dinucleotide: 134, 135, 137, 138, 139, 158, 159, 160, 165, 166, 204, 205, 249, 250, 295, 381, 417, 418, 423, 424, 425, 554
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
26% identity, 33% coverage: 429:704/826 of query aligns to 573:843/965 of Q50LF0
Sites not aligning to the query:
- 139 binding
- 158 binding
- 159 binding
- 160 binding
- 166 binding
- 205 binding
- 418 binding
- 423 binding
- 425 binding
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
26% identity, 33% coverage: 429:704/826 of query aligns to 572:842/963 of 3ad7A
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
26% identity, 33% coverage: 429:704/826 of query aligns to 572:842/963 of 1vrqA
- active site: D676 (= D543)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (≠ F499), Y663 (= Y530), G677 (≠ F544), H690 (≠ V557), I774 (≠ L636), F776 (≠ Y638), E783 (= E645), K822 (= K684), F824 (≠ Y686)
Sites not aligning to the query:
- active site: 349, 374
- binding flavin mononucleotide: 509, 510, 516, 520, 548, 550
- binding nicotinamide-adenine-dinucleotide: 134, 136, 137, 138, 157, 158, 159, 165, 204, 248, 249, 294, 380, 416, 422, 423, 424
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
26% identity, 43% coverage: 430:781/826 of query aligns to 2:334/371 of 1wsvA
- active site: D98 (= D543)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ F499), L85 (≠ Y530), D98 (= D543), L99 (≠ F544), I100 (≠ T545), V112 (= V557), N114 (≠ G559), F173 (= F616), G193 (≠ T637), Y194 (= Y638), E201 (= E645), R230 (≠ I677), L239 (≠ Y686)
Sites not aligning to the query:
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
26% identity, 44% coverage: 418:781/826 of query aligns to 20:365/403 of P48728
- D129 (= D543) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ G559) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E645) binding
- R261 (≠ I677) binding
- G269 (= G685) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (= R733) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
24% identity, 46% coverage: 12:393/826 of query aligns to 23:387/403 of 2gagB
- active site: A61 (≠ W49), T64 (≠ A52), T65 (≠ G53)
- binding flavin-adenine dinucleotide: G26 (= G15), G28 (= G17), G29 (≠ I18), H30 (≠ I19), E51 (= E39), K52 (≠ Q40), G58 (= G46), N59 (≠ T47), M60 (≠ T48), R62 (≠ H50), N63 (≠ A51), T64 (≠ A52), I66 (≠ L54), V195 (= V178), G224 (≠ A216), A225 (≠ G217), H227 (≠ W219), L231 (≠ V223), L246 (≠ H238), G352 (≠ N358), T353 (≠ S359), G354 (≠ M360), G355 (= G361), F356 (≠ I362), K357 (≠ A363)
- binding flavin mononucleotide: A61 (≠ W49), R62 (≠ H50), H171 (≠ P154), V250 (= V242), E278 (≠ G271), R321 (≠ Q326), W323 (≠ Y328)
- binding 2-furoic acid: T64 (≠ A52), I66 (≠ L54), R68 (≠ G56), M263 (= M256), Y270 (≠ I263), K357 (≠ A363)
- binding sulfite ion: K170 (≠ N153), K276 (≠ V269)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_06542 H281DRAFT_06542 4-methylaminobutanoate oxidase (formaldehyde-forming)
MSTSIPQRARVVIIGGGIIGCSVAYHLTKLGWTDVVLLEQGQLSCGTTWHAAGLVGQLRA
QESMTKLIRYSTALYAELEAETGLATGWKQCGSLSVARTAERMTQLKRTAAVARAYGVAC
DVIGAREAGDLWPVMRTDDLLGAVWLPGDGKANPTDLTQALARGARMRGARIVENTRVTA
THTRDAHGAREATGVAWRNKDGDEGTIGAEIVVNCAGQWAKAVGRLCDVTVPLHSAEHYY
IVTERIAGVHPDLPVMRDPDGFIYFKEEVGGLVMGGFEPNAKPWGMQGIPEHFEFQLLPD
DWDQFEILMTNALQRVPALETAQVRQFYNGPESFTPDNNFMLGEAPELRRFFVGAGFNSM
GIASAGGAGMALAEWIVAGEPTMDLWPVDIRRFARFNGNDTWLHDRVKETLGLHYAMPWP
NRELDSARPFRRSPLYALLREDGACFGSKMGWERANFFAPTRDEARIDYAFGQQNWLPLS
GAEHRACRERVALFDMTSFSKFLVKGRDAQSVLQNLVANDVDVPPGTTVYTGMLNERGNY
ESDFTLTRLAADQYLLVTGTAQTTRDFDMIDKAIPRDKHCVLVDVTSQYAVLAVMGPRSR
ELLQSVSKADWRNESFAFGQSREVDIGYATVRATRLTYVGELGWELYVPVEFAVGVYEIL
HEAGKAFGLVNAGYYAIDSLRIEKGYRAWGRELTPDTNPFEAALAFACKLDTDIPFRGRD
ALAELRGKPLRRRMVVLTADGAADRMLWGGEAILRDGKPVGFVSSAAFGHTLGCPVAMGY
VNNSDGEADSAYLTSGAYAIDVAGELLPATLHLKAPYDPRSERIRN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory