Comparing H281DRAFT_06609 FitnessBrowser__Burk376:H281DRAFT_06609 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
57% identity, 99% coverage: 1:197/198 of query aligns to 169:365/365 of 6s87D
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
48% identity, 99% coverage: 2:197/198 of query aligns to 176:371/372 of P39120
1a59A Cold-active citrate synthase (see paper)
47% identity, 97% coverage: 1:193/198 of query aligns to 177:377/377 of 1a59A
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
47% identity, 97% coverage: 1:193/198 of query aligns to 179:379/379 of O34002
Sites not aligning to the query:
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
40% identity, 99% coverage: 2:197/198 of query aligns to 175:371/371 of 1ixeA
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
41% identity, 99% coverage: 1:197/198 of query aligns to 171:370/370 of 6abxA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
41% identity, 99% coverage: 1:197/198 of query aligns to 171:370/372 of 6abyA
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
42% identity, 99% coverage: 2:197/198 of query aligns to 175:374/374 of 1iomA
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
44% identity, 99% coverage: 2:197/198 of query aligns to 168:369/369 of 6abwA
I6Y9Q3 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
44% identity, 94% coverage: 2:188/198 of query aligns to 200:386/393 of I6Y9Q3
Sites not aligning to the query:
1aj8A Citrate synthase from pyrococcus furiosus (see paper)
41% identity, 100% coverage: 1:198/198 of query aligns to 175:371/371 of 1aj8A
4yboB Structure of citrate synthase from the thermoacidophilic euryarchaeon thermolasma acidophilum (see paper)
42% identity, 100% coverage: 1:198/198 of query aligns to 176:381/381 of 4yboB
2ifcC The structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum
42% identity, 100% coverage: 1:198/198 of query aligns to 177:382/382 of 2ifcC
2r9eA The structure of the binary complex of citryl dethia coa and citrate synthase from the thermophilic archaeonthermoplasma acidophilum
41% identity, 99% coverage: 1:197/198 of query aligns to 177:381/381 of 2r9eA
2r26A The structure of the ternary complex of carboxymethyl coenzyme a and oxalateacetate with citrate synthase from the thermophilic archaeonthermoplasma acidophilum
41% identity, 99% coverage: 1:197/198 of query aligns to 177:381/381 of 2r26A
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 97% coverage: 5:197/198 of query aligns to 228:431/431 of P9WPD5
2c6xA Structure of bacillus subtilis citrate synthase
36% identity, 93% coverage: 5:189/198 of query aligns to 173:363/363 of 2c6xA
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
36% identity, 93% coverage: 5:189/198 of query aligns to 174:364/366 of P39119
8gmiA Citrate synthase (cita) in mycobacterium tuberculosis modified by ebselen at c143 residue (see paper)
39% identity, 91% coverage: 7:186/198 of query aligns to 173:354/369 of 8gmiA
Sites not aligning to the query:
8gi7A C143a variant of citrate synthase (cita) in mycobacterium tuberculosis (see paper)
39% identity, 91% coverage: 7:186/198 of query aligns to 171:352/368 of 8gi7A
>H281DRAFT_06609 FitnessBrowser__Burk376:H281DRAFT_06609
VSLNLYAEHEFNASTFTGRVIAGTGSDIYSAITGAIGALRGPKHGGANEVAFEIQSRYQT
PDEAESDIRRRVENKEVVIGFGHPVYTISDPRNKVIKEVAKKLSKEAGNNKLFDIAERLE
SVMWEAKKMFPNLDWFSAVSYHMMGVPTAMFTPLFVIARTAGWSAHIIEQRLDNKIIRPS
ANYTGPENLKYVPLNRRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory