Comparing HSERO_RS00310 FitnessBrowser__HerbieS:HSERO_RS00310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 92% coverage: 18:256/259 of query aligns to 1:236/241 of 2q2aA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 90% coverage: 25:256/259 of query aligns to 2:230/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
40% identity, 87% coverage: 31:256/259 of query aligns to 4:226/231 of 2q2cA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
41% identity, 85% coverage: 29:249/259 of query aligns to 5:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
41% identity, 85% coverage: 29:249/259 of query aligns to 5:223/225 of 4zv2A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
40% identity, 85% coverage: 29:249/259 of query aligns to 11:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
34% identity, 85% coverage: 31:249/259 of query aligns to 13:227/229 of 6svfA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
34% identity, 86% coverage: 28:249/259 of query aligns to 14:234/235 of 4g4pA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
35% identity, 86% coverage: 26:249/259 of query aligns to 1:221/226 of 8eyzA
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
31% identity, 85% coverage: 29:248/259 of query aligns to 1:219/223 of 8b5dA
8b5eA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
30% identity, 86% coverage: 27:248/259 of query aligns to 1:221/225 of 8b5eA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
30% identity, 86% coverage: 27:248/259 of query aligns to 2:222/226 of 6fxgB
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
33% identity, 85% coverage: 31:249/259 of query aligns to 4:222/224 of 4ymxA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
30% identity, 86% coverage: 30:253/259 of query aligns to 8:230/230 of 4kqpA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
32% identity, 85% coverage: 28:248/259 of query aligns to 16:235/239 of 4zefA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
28% identity, 86% coverage: 28:249/259 of query aligns to 6:227/228 of 2y7iA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
30% identity, 87% coverage: 28:253/259 of query aligns to 26:257/260 of P0AEU0
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
30% identity, 87% coverage: 28:253/259 of query aligns to 4:235/238 of 1hslA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
31% identity, 86% coverage: 32:253/259 of query aligns to 17:234/237 of 3vv5A
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
30% identity, 87% coverage: 28:253/259 of query aligns to 26:257/260 of P02910
Sites not aligning to the query:
>HSERO_RS00310 FitnessBrowser__HerbieS:HSERO_RS00310
MSLKKLLTTAASALALSCAAGTALAADQTYVVGAGGTYRPFEFETPKKELVGFDIDLIKA
ISQASNFKIQLVSTPWEGIFATLGQGDRDIIISGITITDKRAQMVDFSLPYFPAEQVIIT
NADAKITSLSDLKKTQVAVVNSTAGDIVVSEELGKASTAIHRFDNTVLMLEELYRGGVDA
AVGDVGVIKFYIKSHPEKKFKVVGDSKFVRQYFGIAVKKGNKELLDKINAGLKKIVADGT
YAKIYKTWFDGDVPTLPLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory