SitesBLAST
Comparing HSERO_RS00780 FitnessBrowser__HerbieS:HSERO_RS00780 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2fdrA Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. C58
35% identity, 83% coverage: 10:188/215 of query aligns to 4:184/222 of 2fdrA
4eenA Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
34% identity, 75% coverage: 11:172/215 of query aligns to 7:171/229 of 4eenA
- active site: D10 (= D14), D12 (= D16), V16 (= V20), S18 (= S22), M44 (≠ A48), Y45 (≠ R49), T47 (≠ R51), S109 (= S111), N110 (= N112), K144 (= K145), E168 (= E169), D169 (= D170)
- binding magnesium ion: D10 (= D14), D12 (= D16), D169 (= D170)
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 83% coverage: 11:189/215 of query aligns to 77:261/1055 of Q8VZ10
- D80 (= D14) mutation to N: Complete rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
Sites not aligning to the query:
- 431:434 CINC→SINS: No rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
- 859 E→K: In soq1-2; high light intensity-dependent and irreversible nonphotochemical quenching (NPQ) due to a decrease in chlorophyll excited-state lifetime.
6w04A Crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss
24% identity, 80% coverage: 11:182/215 of query aligns to 4:181/223 of 6w04A
- active site: D7 (= D14), F8 (≠ C15), N9 (≠ D16), D15 (≠ S22), N44 (≠ R51), T109 (≠ S111), S110 (≠ N112), K144 (= K145), E168 (= E169), D169 (= D170)
- binding magnesium ion: D7 (= D14), N9 (≠ D16), D169 (= D170)
1te2A Putative phosphatase ynic from escherichia coli k12
29% identity, 82% coverage: 12:188/215 of query aligns to 7:187/218 of 1te2A
- active site: D9 (= D14), D11 (= D16), S17 (= S22), D44 (≠ R49), S111 (= S111), A112 (≠ N112), K144 (= K145), E168 (= E169), D169 (= D170)
- binding calcium ion: D9 (= D14), D11 (= D16), D169 (= D170)
- binding 2-phosphoglycolic acid: D9 (= D14), M10 (≠ C15), D11 (= D16), G47 (= G52), S111 (= S111), A112 (≠ N112), K144 (= K145)
4uavA Crystal structure of cbby (at3g48420) from arabidobsis thaliana (see paper)
30% identity, 95% coverage: 6:209/215 of query aligns to 1:225/246 of 4uavA
Q94K71 CBBY-like protein; AtCbby; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 97% coverage: 2:209/215 of query aligns to 70:298/319 of Q94K71
- D84 (= D16) mutation to N: Loss of catalytic activity.
- E91 (= E23) mutation to A: 40% to 80% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
- H95 (≠ A27) mutation to A: 40% to 80% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
- Y117 (= Y37) mutation to A: 40% to 80% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
- R129 (≠ D45) mutation to A: 97% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
- K161 (≠ E77) mutation to A: 40% to 80% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
P77247 Hexitol phosphatase B; 2-deoxyglucose-6-phosphate phosphatase; Mannitol-1-phosphatase; Sorbitol-6-phosphatase; Sugar-phosphatase; EC 3.1.3.68; EC 3.1.3.22; EC 3.1.3.50; EC 3.1.3.23 from Escherichia coli (strain K12) (see paper)
29% identity, 82% coverage: 12:188/215 of query aligns to 11:191/222 of P77247
- D13 (= D14) binding ; mutation to A: Loss of phosphatase activity.
- D15 (= D16) binding
- D173 (= D170) binding
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
29% identity, 83% coverage: 11:188/215 of query aligns to 7:191/227 of 4g9bA
- active site: D10 (= D14), L11 (≠ C15), D12 (= D16), T18 (≠ S22), K46 (≠ R51), S117 (= S111), V118 (vs. gap), K148 (= K145), E172 (= E169), D173 (= D170)
- binding magnesium ion: D10 (= D14), D12 (= D16), D173 (= D170)
3dv9A Putative beta-phosphoglucomutase from bacteroides vulgatus.
28% identity, 87% coverage: 11:197/215 of query aligns to 26:214/243 of 3dv9A
- active site: D29 (= D14), M30 (≠ C15), D31 (= D16), S37 (= S22), E65 (≠ R51), T131 (≠ A110), G132 (≠ S111), K162 (= K145), E186 (= E169), N187 (≠ D170)
- binding magnesium ion: D29 (= D14), D31 (= D16), E65 (≠ R51), N187 (≠ D170)
4ex7A Crystal structure of the alnumycin p phosphatase in complex with free phosphate (see paper)
28% identity, 87% coverage: 11:196/215 of query aligns to 4:193/217 of 4ex7A
4ex6A Crystal structure of the alnumycin p phosphatase alnb (see paper)
28% identity, 87% coverage: 11:196/215 of query aligns to 6:195/219 of 4ex6A
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
27% identity, 90% coverage: 11:204/215 of query aligns to 5:201/224 of 5olwA
- active site: D8 (= D14), L9 (≠ C15), D10 (= D16), T16 (≠ S22), K45 (≠ R51), S114 (= S111), A115 (vs. gap), K145 (= K145), E169 (= E169), D170 (= D170)
- binding calcium ion: D8 (= D14), D10 (= D16), P89 (= P92), V92 (vs. gap), E124 (≠ R123), N127 (≠ G126), E169 (= E169), D170 (= D170), S171 (= S171)
P71447 Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see 3 papers)
27% identity, 90% coverage: 11:204/215 of query aligns to 5:201/221 of P71447
- D8 (= D14) modified: 4-aspartylphosphate; mutation to A: Inactive.; mutation to E: Inactive.
- D10 (= D16) mutation to A: Inactive.; mutation to E: Inactive.; mutation to N: Inactive.; mutation to S: Inactive.
- T16 (≠ S22) mutation to P: 500-fold reduction in the rate constant for Asp-8 phosphorylation by beta-G1,6bisP. 6,700-fold reduction in the apparent rate constant for cycling of the phosphorylated enzyme to convert beta-G1P to G6P. 13-fold increase in the estimated rate constant for phosphoryl transfer from the phospho-Asp8 to water.
- H20 (≠ A26) mutation to A: Impairs Asp-8 phosphorylation by beta-G1,6bisP and phosphoryl transfer from the phospho-Asp8 to the substrate beta-G1P.; mutation to N: 300-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.; mutation to Q: 8-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- K45 (≠ R51) mutation to A: 20'000-fold decrease in kcat/KM.
- G46 (= G52) mutation to A: 1'000'000-fold decrease in kcat/KM.; mutation to P: 100'000-fold decrease in kcat/KM.; mutation to V: 10'000-fold decrease in kcat/KM.
- R49 (≠ M55) mutation to K: 1'000'000-fold decrease in kcat/KM.
- S52 (≠ C58) mutation to A: Wild-type activity.
- K76 (≠ M82) mutation to A: 100-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- D170 (= D170) mutation to A: Impaired, but active with an increase in the affinity for G1P.
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
27% identity, 90% coverage: 11:204/215 of query aligns to 5:201/221 of 2wf9A
- active site: D8 (= D14), L9 (≠ C15), D10 (= D16), T16 (≠ S22), K45 (≠ R51), S114 (= S111), A115 (vs. gap), K145 (= K145), E169 (= E169), D170 (= D170)
- binding beryllium trifluoride ion: D8 (= D14), L9 (≠ C15), D10 (= D16), S114 (= S111), A115 (vs. gap), K145 (= K145)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D16), H20 (≠ A26), G46 (= G52), V47 (= V53), R49 (≠ M55), S116 (vs. gap), K117 (vs. gap), N118 (= N112)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D16), H20 (≠ A26), G46 (= G52), V47 (= V53), R49 (≠ M55), A115 (vs. gap), S116 (vs. gap), K117 (vs. gap), N118 (= N112)
- binding magnesium ion: D8 (= D14), D10 (= D16), D170 (= D170)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
27% identity, 90% coverage: 11:204/215 of query aligns to 5:201/221 of 1o03A
- active site: D8 (= D14), L9 (≠ C15), D10 (= D16), T16 (≠ S22), K45 (≠ R51), S114 (= S111), A115 (vs. gap), K145 (= K145), E169 (= E169), D170 (= D170)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D14), L9 (≠ C15), D10 (= D16), H20 (≠ A26), G46 (= G52), V47 (= V53), R49 (≠ M55), S114 (= S111), A115 (vs. gap), S116 (vs. gap), K117 (vs. gap), K145 (= K145)
- binding magnesium ion: D8 (= D14), D10 (= D16), D170 (= D170)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
27% identity, 90% coverage: 11:204/215 of query aligns to 5:201/221 of 1lvhA
- active site: D8 (= D14), L9 (≠ C15), D10 (= D16), T16 (≠ S22), K45 (≠ R51), S114 (= S111), A115 (vs. gap), K145 (= K145), E169 (= E169), D170 (= D170)
- binding magnesium ion: D8 (= D14), D10 (= D16), D170 (= D170)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
27% identity, 90% coverage: 11:204/215 of query aligns to 5:201/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
27% identity, 90% coverage: 11:204/215 of query aligns to 5:201/218 of 4c4rA
- active site: D8 (= D14), L9 (≠ C15), D10 (= D16), T16 (≠ S22), K45 (≠ R51), S114 (= S111), A115 (vs. gap), K145 (= K145), E169 (= E169), D170 (= D170)
- binding magnesium ion: D8 (= D14), D10 (= D16), D170 (= D170)
- binding trifluoromagnesate: D8 (= D14), L9 (≠ C15), D10 (= D16), S114 (= S111), A115 (vs. gap), K145 (= K145)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D16), H20 (≠ A26), W24 (= W30), L44 (≠ F50), G46 (= G52), V47 (= V53), R49 (≠ M55), S52 (≠ C58), S116 (vs. gap), K117 (vs. gap)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
27% identity, 90% coverage: 11:204/215 of query aligns to 5:201/218 of 3zi4A
- active site: D8 (= D14), L9 (≠ C15), D10 (= D16), T16 (≠ S22), K45 (≠ R51), S114 (= S111), A115 (vs. gap), K145 (= K145), E169 (= E169), D170 (= D170)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D16), H20 (≠ A26), G46 (= G52), V47 (= V53), R49 (≠ M55), S116 (vs. gap), K117 (vs. gap)
- binding magnesium ion: D8 (= D14), D10 (= D16), D170 (= D170)
- binding Scandium Tetrafluoride: D8 (= D14), L9 (≠ C15), D10 (= D16), S114 (= S111), A115 (vs. gap), K145 (= K145)
Query Sequence
>HSERO_RS00780 FitnessBrowser__HerbieS:HSERO_RS00780
MNDFATSPALVIFDCDGTLVDSEVVAARAWSEYVATYGVQLTPEDALARFRGVSMSWCIA
HVAQLRGQALPAHFEQELRARMGVMLEQHLQPINGALEMVEQLQIPFALASNAPHHKIEL
CLRVTGLLPHFHGRIFSAYDVQRWKPDPALFLFAAERLGVPPARCAVVEDSLPGVQAGLA
AGMKVIALQEHGVHPDLPEEVAVITHLGQLHPHLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory