SitesBLAST
Comparing HSERO_RS00880 FitnessBrowser__HerbieS:HSERO_RS00880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
30% identity, 88% coverage: 31:306/312 of query aligns to 37:297/303 of 4bv9A
- active site: G58 (= G52), S220 (≠ F223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (≠ A79), H83 (≠ I80), T111 (= T108), G134 (= G131), G136 (= G133), V137 (= V134), Q138 (= Q135), N159 (≠ A160), R160 (= R161), T161 (= T162), V195 (≠ L199), T196 (= T200), M197 (≠ T201), A198 (≠ S202), V217 (= V220), G218 (= G221), S283 (≠ T292), L284 (≠ V293), G285 (= G294)
- binding pyruvic acid: R45 (= R39), M60 (= M53), K73 (= K64), R110 (= R107)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
29% identity, 88% coverage: 31:306/312 of query aligns to 39:306/314 of Q14894
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
29% identity, 88% coverage: 31:306/312 of query aligns to 38:305/312 of 2i99A
- active site: G59 (= G52), S228 (≠ F223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D81 (= D71), S90 (≠ A79), H91 (≠ I80), R118 (= R107), T119 (= T108), G142 (= G131), A143 (≠ T132), G144 (= G133), V145 (= V134), Q146 (= Q135), N167 (≠ A156), R168 (= R157), T169 (≠ D158), V203 (≠ L199), T204 (= T200), L205 (≠ T201), A206 (≠ S202), V225 (= V220), G226 (= G221), S291 (≠ T292), L292 (≠ V293), G293 (= G294)
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
30% identity, 88% coverage: 31:306/312 of query aligns to 38:296/303 of 4bvaA
- active site: G59 (= G52), S219 (≠ F223)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T104), R109 (= R107), T110 (= T108), G135 (= G133), V136 (= V134), Q137 (= Q135), N158 (≠ A160), R159 (= R161), T160 (= T162), N163 (≠ L169), V194 (≠ L199), T195 (= T200), M196 (≠ T201), A197 (≠ S202), V216 (= V220), S282 (≠ T292), L283 (≠ V293), G284 (= G294)
- binding 3,5,3'triiodothyronine: R46 (= R39), F57 (≠ L50), G59 (= G52), V76 (≠ I66), F78 (≠ V68), S219 (≠ F223), R220 (≠ K224), W223 (≠ M227), E247 (= E251)
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
24% identity, 98% coverage: 1:305/312 of query aligns to 1:309/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ A79), T111 (= T108), G136 (= G133), V137 (= V134), Q138 (= Q135), D159 (≠ A156), I160 (≠ R157), A199 (≠ L199), T200 (= T200), T201 (= T201), A202 (≠ S202), V206 (= V206), V221 (= V220), G222 (= G221), W223 (≠ A222), S296 (≠ T292), V297 (= V293), G298 (= G294)
- binding proline: R39 (= R39), M54 (= M53), K67 (= K64), R110 (= R107)
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 79% coverage: 64:309/312 of query aligns to 71:320/325 of Q9FLY0
- G89 (= G82) mutation to E: In sard4-3; compromises systemic acquired resistance (SAR).
- G138 (= G131) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (≠ I197) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
27% identity, 97% coverage: 3:306/312 of query aligns to 5:304/320 of 1omoA
- active site: R52 (≠ L51), D219 (≠ F223)
- binding nicotinamide-adenine-dinucleotide: T109 (= T108), G134 (= G133), T135 (≠ V134), Q136 (= Q135), Y156 (≠ R157), D157 (= D158), V158 (≠ L159), R159 (= R161), T195 (= T200), P196 (≠ T201), G217 (= G221), D219 (≠ F223), K223 (≠ M227), S290 (≠ T292), T291 (≠ V293), G292 (= G294)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
27% identity, 97% coverage: 3:306/312 of query aligns to 5:304/322 of O28608
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
27% identity, 75% coverage: 71:304/312 of query aligns to 76:305/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ D71)
- binding nicotinamide-adenine-dinucleotide: T113 (= T108), G138 (= G133), Q140 (= Q135), P162 (vs. gap), H163 (= H173), I199 (≠ L199), T200 (= T200), S201 (≠ T201), S202 (= S202), M221 (≠ V220), G222 (= G221), D224 (≠ F223), K228 (≠ M227), G293 (≠ T292), T294 (≠ V293), G295 (= G294)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
27% identity, 75% coverage: 71:304/312 of query aligns to 76:305/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ I80), T113 (= T108), G138 (= G133), H139 (≠ V134), Q140 (= Q135), N161 (≠ R172), P162 (vs. gap), H163 (= H173), M166 (≠ A176), I199 (≠ L199), T200 (= T200), S201 (≠ T201), S202 (= S202), M221 (≠ V220), G222 (= G221), D224 (≠ F223), K228 (≠ M227), G293 (≠ T292)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
27% identity, 75% coverage: 71:304/312 of query aligns to 74:303/320 of A1B8Z0
5gzlA Cyclodeaminase_pa
29% identity, 80% coverage: 57:306/312 of query aligns to 75:319/357 of 5gzlA
- binding lysine: D240 (≠ F223), R267 (≠ H250), E268 (= E251)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ T67), T97 (≠ A79), I98 (= I80), T126 (= T108), G151 (= G133), A152 (≠ V134), Q153 (= Q135), D174 (≠ A156), T175 (≠ R157), H179 (≠ R161), A212 (≠ L199), T213 (= T200), S214 (≠ T201), V222 (= V206), V237 (= V220), G238 (= G221), A239 (= A222), D240 (≠ F223), K244 (≠ M227), S305 (≠ T292), T306 (≠ V293), G307 (= G294)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
29% identity, 80% coverage: 57:306/312 of query aligns to 75:319/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ T67), T97 (≠ A79), R125 (= R107), T126 (= T108), G151 (= G133), A152 (≠ V134), Q153 (= Q135), D174 (≠ A156), T175 (≠ R157), H179 (≠ R161), A212 (≠ L199), T213 (= T200), S214 (≠ T201), V215 (vs. gap), V237 (= V220), G238 (= G221), A239 (= A222), S305 (≠ T292), T306 (≠ V293), G307 (= G294)
- binding (2S)-piperidine-2-carboxylic acid: K81 (≠ T63), R125 (= R107), A239 (= A222), T306 (≠ V293), G307 (= G294)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
29% identity, 80% coverage: 57:306/312 of query aligns to 71:315/344 of 5yu4A
- binding 2,4-diaminobutyric acid: K77 (≠ T63), R121 (= R107), T302 (≠ V293), G303 (= G294)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ T67), T93 (≠ A79), I94 (= I80), R121 (= R107), T122 (= T108), G147 (= G133), A148 (≠ V134), Q149 (= Q135), D170 (≠ A156), T171 (≠ R157), H175 (≠ R161), A208 (≠ L199), T209 (= T200), S210 (≠ T201), V211 (vs. gap), V218 (= V206), V233 (= V220), A235 (= A222), S301 (≠ T292), T302 (≠ V293), G303 (= G294)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
29% identity, 80% coverage: 57:306/312 of query aligns to 71:315/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ T67), T93 (≠ A79), I94 (= I80), T122 (= T108), G147 (= G133), A148 (≠ V134), Q149 (= Q135), D170 (≠ A156), T171 (≠ R157), A208 (≠ L199), T209 (= T200), S210 (≠ T201), V211 (vs. gap), V233 (= V220), A235 (= A222), S301 (≠ T292), T302 (≠ V293), G303 (= G294)
- binding proline: K77 (≠ T63), R121 (= R107)
Sites not aligning to the query:
7cxuB Crystal structure of cmnk in complex with NAD+ (see paper)
31% identity, 34% coverage: 64:168/312 of query aligns to 75:180/327 of 7cxuB
Sites not aligning to the query:
Query Sequence
>HSERO_RS00880 FitnessBrowser__HerbieS:HSERO_RS00880
MHILDPRQTAQALPYAALVDALARATQELADGRIRAPERQVVPIDAASVLLGMPAIADDL
SVTKLITVHADNARHQLPAIQGEVIAFETQTGRRLALMDGPTVTARRTAAMSMLGIRTLL
PRQPQSALLIGTGVQSAAHADALVEFFGVRQFWIVARDLARTQAFCRALSERHPQAVASP
LPAQMLQQDLPHTDVVIALTTSRSAVIPEHIAADTLAIGVGAFKPDMVEFPASLLHARRI
VVDDLAGAHHEAGDLIQAGVDWSGVVAIADVVAGRAPAAALASGAALPVFKTVGQAAWDL
AAARVMRATLGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory