SitesBLAST
Comparing HSERO_RS01150 FitnessBrowser__HerbieS:HSERO_RS01150 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 54% coverage: 2:236/433 of query aligns to 22:234/444 of Q8NLB7
- D54 (≠ N30) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R88) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
27% identity, 44% coverage: 57:248/433 of query aligns to 143:311/517 of 8et9A
Sites not aligning to the query:
O15244 Solute carrier family 22 member 2; Organic cation transporter 2; hOCT2 from Homo sapiens (Human) (see 8 papers)
26% identity, 43% coverage: 61:248/433 of query aligns to 149:313/555 of O15244
- M165 (≠ I80) to I: lower Vmax for MPP(+) transport; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177507
- Y169 (≠ I84) mutation to F: No change in TEA uptake.
- T201 (≠ E116) to M: in dbSNP:rs145450955
- Y241 (≠ V172) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-362 and F-377.
- Y257 (≠ A189) mutation to F: No change in TEA uptake.
- S270 (≠ G203) to A: decreased Ki value for TBA inhibition of MPP(+); no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs316019
- Y279 (≠ H215) mutation to F: No change in TEA uptake.
- Y280 (≠ H216) mutation to F: No change in TEA uptake.
- P284 (≠ E218) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- PESPR 284:288 (≠ EETPT 218:222) Proline-rich sequence
- S286 (≠ T220) mutation to A: No change in TEA and metformin uptake. No change in tyrosine phosphorylation.
- P287 (= P221) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
Sites not aligning to the query:
- 54 P → S: in dbSNP:rs8177504
- 73 Y→F: No change in TEA uptake.
- 92 Y→F: No change in TEA uptake.
- 128 Y→F: No change in TEA uptake.
- 362 Y→F: Decreased TEA uptake and YES1-mediated tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-241. Strong decrease in TEA uptake; when associated with F-377. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-377.
- 377 Y→F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-362.
- 400 R → C: lower Vmax and reduced Ki value for TBA inhibition of MPP(+); lower transport efficiency (Vmax/Km) and clearance of cyclo(his-pro); no change in transport efficiency (Vmax/Km) and clearance of salsolinol; dbSNP:rs8177516
- 432 K → Q: lower Km value for MPP(+) and reduced Ki value for TBA inhibition of MPP; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177517
- 458 Y→F: No change in TEA uptake.
- 544 Y→F: No change in TEA uptake.
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
29% identity, 39% coverage: 66:235/433 of query aligns to 152:299/532 of 8et8A
Sites not aligning to the query:
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: 31, 35, 353, 360, 378, 381, 385, 449, 469
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
29% identity, 39% coverage: 66:235/433 of query aligns to 152:299/532 of 8et7A
Sites not aligning to the query:
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
24% identity, 75% coverage: 57:381/433 of query aligns to 126:412/453 of 8sc2A
Sites not aligning to the query:
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
36% identity, 20% coverage: 66:151/433 of query aligns to 154:228/556 of Q63089
- C155 (≠ T67) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- C179 (≠ A94) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ F135) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ S136) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ A137) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G138) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (= G139) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ E140) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (≠ M141) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ G142) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (= S143) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ A144) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ T145) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (≠ A146) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (≠ F147) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ L148) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (= T149) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E150) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ Y151) mutation to I: No change in TEA and MPP(+) uptake.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 229 V→A: Decreased TEA and MPP(+) uptake.; V→L: Loss of TEA and MPP(+) uptake activity.
- 286 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- 292 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- 296 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- 322 C→S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- 328 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
24% identity, 75% coverage: 57:381/433 of query aligns to 126:405/447 of 8sc6A
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
35% identity, 20% coverage: 66:151/433 of query aligns to 154:228/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
5c65A Structure of the human glucose transporter glut3 / slc2a3
26% identity, 43% coverage: 53:240/433 of query aligns to 50:224/457 of 5c65A
Sites not aligning to the query:
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
24% identity, 75% coverage: 57:381/433 of query aligns to 126:403/445 of 8sc3A
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
26% identity, 43% coverage: 53:240/433 of query aligns to 54:228/470 of 7sptA
Sites not aligning to the query:
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
26% identity, 43% coverage: 53:240/433 of query aligns to 52:226/469 of 7crzA
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: 26, 278, 279, 284, 313, 375, 384, 411, 412, 415
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
26% identity, 43% coverage: 53:240/433 of query aligns to 51:225/468 of 7spsA
Sites not aligning to the query:
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: 21, 25, 29, 278, 286, 308, 312, 374, 375, 406, 407, 410
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
26% identity, 43% coverage: 53:240/433 of query aligns to 54:228/470 of 4zw9A
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
23% identity, 74% coverage: 77:395/433 of query aligns to 66:420/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
23% identity, 74% coverage: 77:395/433 of query aligns to 66:420/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
23% identity, 74% coverage: 77:395/433 of query aligns to 66:420/475 of 4gbyA
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
24% identity, 78% coverage: 57:393/433 of query aligns to 144:483/554 of O15245
- L160 (≠ F73) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (≠ G105) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A144) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ I164) mutation to F: Decreased TEA uptake.
- P283 (= P199) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (vs. gap) to G: in dbSNP:rs4646278
- P341 (= P242) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (= R243) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (= Y269) mutation to F: Decreased TEA uptake.
- Y376 (≠ F282) mutation to F: Decreased TEA uptake.
- G401 (= G307) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (vs. gap) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (≠ L320) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (≠ T348) to I: in dbSNP:rs35956182
- V461 (= V369) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G373) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
23% identity, 83% coverage: 38:395/433 of query aligns to 34:424/491 of P0AGF4
- G83 (= G90) mutation to A: Abolishes xylose transport.
- R133 (= R130) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E150) mutation to A: Abolishes xylose transport.
- R160 (= R157) mutation to A: Abolishes xylose transport.
- Q168 (= Q165) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ L254) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ LW 254:255) binding
- Q289 (≠ W255) mutation to A: Strongly decreases xylose transport.
- N294 (≠ Y260) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ F264) mutation to A: Abolishes xylose transport.
- N325 (≠ I292) mutation to A: No effect on xylose transport.
- G340 (= G307) mutation to A: Abolishes xylose transport.
- R341 (= R308) mutation R->A,W: Abolishes xylose transport.
- W392 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E363) mutation to A: Abolishes xylose transport.
- R404 (≠ L370) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ A381) binding
- W416 (≠ G387) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
Query Sequence
>HSERO_RS01150 FitnessBrowser__HerbieS:HSERO_RS01150
MQASTLPADGIVSVSNQQRRRAIVATVIGNGLEWFDFTVYSFFAVIIAKLFFPTGNDLTS
LLLAVATFGVGFFMRPVGGILLGIYADRVGRKAALSVTILLMAVGTTMIGLAPTYESIGL
FAPLIIVVARLLQGFSAGGEMGSATAFLTEYAPERERAYYSSWIQASIGVAVLLGAAVGT
FVTASLDAAALASWGWRLPFLLGIIIGPVGYYIRHHLEETPTFLEEKDKTDSPLKEVIRN
FPRETSASFSMVILWTVCTYVLLFYMPTYSVKVLKLPQTTGFIAGMVGGLCIMVLAPIVG
RLADRIGRRPLLSGSAALILMLAYPMFAYINSAPSLSTLLIFQLVFGTLIAAYTGPILAA
FSELFPAKVLSTGLSVAYNLAVTIFGGFASFFITWLIAATGSTMAPAFYVMIAAAISFVG
TRFVREPQYLQPH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory