Comparing HSERO_RS01185 FitnessBrowser__HerbieS:HSERO_RS01185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 84% coverage: 31:257/269 of query aligns to 3:229/229 of 5t0wA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 80% coverage: 40:255/269 of query aligns to 6:224/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 80% coverage: 40:255/269 of query aligns to 6:222/225 of 4zv2A
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
30% identity, 84% coverage: 31:257/269 of query aligns to 7:232/251 of 1xt8B
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
30% identity, 80% coverage: 40:254/269 of query aligns to 13:229/247 of 2yjpA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
29% identity, 84% coverage: 31:256/269 of query aligns to 3:227/229 of 6svfA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
29% identity, 86% coverage: 31:260/269 of query aligns to 1:235/237 of 4i62A
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
29% identity, 83% coverage: 36:259/269 of query aligns to 1:224/226 of 8eyzA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
26% identity, 81% coverage: 39:256/269 of query aligns to 5:226/234 of 3k4uE
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
31% identity, 82% coverage: 35:255/269 of query aligns to 11:233/235 of 4g4pA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
30% identity, 87% coverage: 23:255/269 of query aligns to 41:271/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
30% identity, 87% coverage: 23:255/269 of query aligns to 40:270/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
30% identity, 87% coverage: 23:255/269 of query aligns to 40:270/287 of 6h1uA
3i6vA Crystal structure of a periplasmic his/glu/gln/arg/opine family- binding protein from silicibacter pomeroyi in complex with lysine
28% identity, 81% coverage: 40:256/269 of query aligns to 2:211/218 of 3i6vA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
27% identity, 66% coverage: 22:198/269 of query aligns to 1:175/241 of 3vvfA
Sites not aligning to the query:
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
27% identity, 66% coverage: 22:198/269 of query aligns to 1:175/241 of 3vveA
Sites not aligning to the query:
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
27% identity, 66% coverage: 22:198/269 of query aligns to 1:175/241 of 3vvdA
Sites not aligning to the query:
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
27% identity, 64% coverage: 27:198/269 of query aligns to 2:171/237 of 3vv5A
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
29% identity, 81% coverage: 39:257/269 of query aligns to 12:232/240 of 4h5fA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
27% identity, 83% coverage: 38:259/269 of query aligns to 11:233/241 of 2q2aA
>HSERO_RS01185 FitnessBrowser__HerbieS:HSERO_RS01185
MHSPSSPARRVQMALLGLLLLGAGAAQADQLDTILAAKKLRVAIDLAVPPYSMKDDKLRL
IGSDVETAQRMAKDFGLELEVVPTTLTNRVPYLQTNKADIVISAFSITPERAKVIDFSVP
YAPILVVVGAPRSMKITSPADLAGKKIIATRGTTNDQELTKIAPSSATITRFDDDATSMT
AMVSGQADIWATSPMLLKVVNQKNPSRDIESKLTLKANLLAVGLRKGEPRLKEKIDGWIR
TNLSNGELNTIYKKYHEAELPPEILHPAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory