Comparing HSERO_RS01190 FitnessBrowser__HerbieS:HSERO_RS01190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 97% coverage: 4:238/242 of query aligns to 3:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 97% coverage: 4:238/242 of query aligns to 3:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 97% coverage: 4:238/242 of query aligns to 3:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 97% coverage: 4:238/242 of query aligns to 3:238/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
57% identity, 90% coverage: 7:224/242 of query aligns to 4:221/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
55% identity, 97% coverage: 4:238/242 of query aligns to 2:236/241 of 4u00A
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
50% identity, 96% coverage: 10:242/242 of query aligns to 8:253/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
50% identity, 96% coverage: 10:242/242 of query aligns to 12:257/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 99% coverage: 4:242/242 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 99% coverage: 4:242/242 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 99% coverage: 4:242/242 of query aligns to 2:246/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 99% coverage: 4:242/242 of query aligns to 2:246/344 of 6cvlD
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 95% coverage: 10:238/242 of query aligns to 32:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
37% identity, 95% coverage: 10:238/242 of query aligns to 32:263/382 of 7aheC
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
37% identity, 89% coverage: 3:217/242 of query aligns to 2:217/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
37% identity, 89% coverage: 3:217/242 of query aligns to 2:217/230 of 6z4wA
7ahdC Opua (e190q) occluded (see paper)
37% identity, 92% coverage: 10:231/242 of query aligns to 32:256/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
35% identity, 98% coverage: 5:240/242 of query aligns to 7:245/375 of 2d62A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 98% coverage: 4:239/242 of query aligns to 17:249/378 of P69874
Sites not aligning to the query:
1g291 Malk (see paper)
36% identity, 98% coverage: 5:240/242 of query aligns to 4:242/372 of 1g291
Sites not aligning to the query:
>HSERO_RS01190 FitnessBrowser__HerbieS:HSERO_RS01190
MHTVVELQGVHKRFGSNTVLRGVSFQVARGEVVAIIGKSGSGKSTALRCINRLEQIDAGQ
ISVCGHALHAAGLDLRGLRRDVGIVFQGYNLFPHLTVLQNITLGPTAVKRMPADQAQTLA
QQVLARVGLADKAGAYPEQLSGGQQQRVAIARSLALQPQLMLFDEVTSALDPELTGEVLK
VMEQMASEGMTMILVTHEMAFARRVADQVIFMHQGQVWEQGGPEILDAPVTPELRSFVGT
GL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory