SitesBLAST
Comparing HSERO_RS01205 FitnessBrowser__HerbieS:HSERO_RS01205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
45% identity, 96% coverage: 12:389/393 of query aligns to 1:371/373 of 6bfgA
- active site: Y129 (= Y140), D156 (= D168), H272 (= H288)
- binding flavin mononucleotide: Y24 (= Y35), P77 (= P88), T78 (= T89), G79 (= G90), Q127 (= Q138), Y129 (= Y140), T154 (= T166), K248 (= K264), H272 (= H288), G273 (= G289), R275 (= R291), D301 (= D319), S302 (≠ G320), G303 (= G321), R305 (= R323), G324 (= G342), R325 (= R343)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
45% identity, 96% coverage: 12:390/393 of query aligns to 3:374/393 of P20932
- PTG 79:81 (= PTG 88:90) binding
- G81 (= G90) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (≠ T117) binding
- Q129 (= Q138) binding
- T156 (= T166) binding
- K250 (= K264) binding
- DSGFR 303:307 (≠ DGGFR 319:323) binding
- GR 326:327 (= GR 342:343) binding
1huvA Crystal structure of a soluble mutant of the membrane-associated (s)- mandelate dehydrogenase from pseudomonas putida at 2.15a resolution (see paper)
43% identity, 95% coverage: 16:390/393 of query aligns to 4:348/349 of 1huvA
- active site: S105 (≠ T117), Y128 (= Y140), T153 (= T166), D155 (= D168), K224 (= K264), H248 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), P76 (= P88), T77 (= T89), G78 (= G90), S105 (≠ T117), Q126 (= Q138), Y128 (= Y140), T153 (= T166), K224 (= K264), H248 (= H288), G249 (= G289), R251 (= R291), D277 (= D319), S278 (≠ G320), G279 (= G321), R281 (= R323), G300 (= G342), R301 (= R343)
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
43% identity, 95% coverage: 16:390/393 of query aligns to 4:352/353 of 2a85A
- active site: S105 (≠ T117), Y128 (= Y140), T153 (= T166), D155 (= D168), K228 (= K264), H252 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), P76 (= P88), T77 (= T89), A78 (≠ G90), S105 (≠ T117), Q126 (= Q138), Y128 (= Y140), T153 (= T166), K228 (= K264), H252 (= H288), G253 (= G289), R255 (= R291), D281 (= D319), S282 (≠ G320), G283 (= G321), R285 (= R323), G304 (= G342), R305 (= R343)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y140), N159 (≠ Y172), G160 (= G173), R162 (= R175), H252 (= H288), R255 (= R291)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
43% identity, 95% coverage: 16:390/393 of query aligns to 4:352/353 of 2a7pA
- active site: S105 (≠ T117), Y128 (= Y140), T153 (= T166), D155 (= D168), K228 (= K264), H252 (= H288)
- binding 3-(indol-3-yl) lactate: Y128 (= Y140), R162 (= R175), H252 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), P76 (= P88), T77 (= T89), A78 (≠ G90), S105 (≠ T117), Q126 (= Q138), Y128 (= Y140), T153 (= T166), K228 (= K264), H252 (= H288), G253 (= G289), R255 (= R291), D281 (= D319), S282 (≠ G320), G283 (= G321), R285 (= R323), G304 (= G342), R305 (= R343)
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
41% identity, 94% coverage: 19:389/393 of query aligns to 12:364/365 of Q8Z0C8
- M82 (≠ T89) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (≠ V119) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (≠ L237) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
36% identity, 95% coverage: 16:388/393 of query aligns to 4:348/353 of 5zbmB
- active site: Y128 (= Y140), D156 (= D168), H248 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), Y24 (≠ V36), P76 (= P88), T77 (= T89), W107 (≠ V119), Q126 (= Q138), Y128 (= Y140), T154 (= T166), K224 (= K264), H248 (= H288), G249 (= G289), R251 (= R291), D279 (= D319), G280 (= G320), R283 (= R323), G302 (= G342), R303 (= R343)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
36% identity, 95% coverage: 16:388/393 of query aligns to 5:354/369 of P05414
- Y24 (= Y35) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (≠ PTG 88:90) binding
- S106 (≠ T117) binding
- W108 (≠ V119) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (≠ QVY 138:140) binding
- T155 (= T166) binding
- K230 (= K264) binding
- S252 (= S286) binding
- DGGVR 285:289 (≠ DGGFR 319:323) binding
- GR 308:309 (= GR 342:343) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
33% identity, 96% coverage: 13:390/393 of query aligns to 4:360/360 of 6gmcA
- active site: Y132 (= Y140), D160 (= D168), H258 (= H288)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y35), M82 (≠ F91), W110 (≠ V119), Y132 (= Y140), R167 (= R175), F191 (= F212), L203 (≠ A233), Y206 (≠ I236), H258 (= H288), R261 (= R291)
- binding flavin mononucleotide: Y26 (= Y35), Y27 (≠ V36), A79 (≠ P88), T80 (= T89), A81 (≠ G90), S108 (≠ T117), Q130 (= Q138), Y132 (= Y140), T158 (= T166), K234 (= K264), H258 (= H288), G259 (= G289), R261 (= R291), D289 (= D319), G290 (= G320), R293 (= R323), G312 (= G342), R313 (= R343)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
33% identity, 96% coverage: 13:390/393 of query aligns to 1:359/359 of 5qigA
- active site: Y129 (= Y140), D157 (= D168), H257 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), Y24 (≠ V36), A76 (≠ P88), T77 (= T89), A78 (≠ G90), S105 (≠ T117), Q127 (= Q138), Y129 (= Y140), T155 (= T166), K233 (= K264), H257 (= H288), G258 (= G289), R260 (= R291), D288 (= D319), G289 (= G320), G290 (= G321), R292 (= R323), G311 (= G342), R312 (= R343)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: L2 (≠ A14), R223 (= R254), G248 (= G279), F320 (≠ A351), K324 (≠ A355), D328 (≠ R359)
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
33% identity, 96% coverage: 13:390/393 of query aligns to 1:359/359 of 5qifA
- active site: Y129 (= Y140), D157 (= D168), H257 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), Y24 (≠ V36), A76 (≠ P88), T77 (= T89), A78 (≠ G90), S105 (≠ T117), Q127 (= Q138), Y129 (= Y140), K233 (= K264), H257 (= H288), G258 (= G289), R260 (= R291), D288 (= D319), G289 (= G320), R292 (= R323), G311 (= G342), R312 (= R343)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R254), R224 (≠ G255), S227 (≠ P258)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
33% identity, 96% coverage: 13:390/393 of query aligns to 1:359/359 of 2rdwA
- active site: S105 (≠ T117), Y129 (= Y140), T155 (= T166), D157 (= D168), K233 (= K264), H257 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), Y24 (≠ V36), A76 (≠ P88), T77 (= T89), A78 (≠ G90), Q127 (= Q138), Y129 (= Y140), T155 (= T166), K233 (= K264), H257 (= H288), G258 (= G289), R260 (= R291), D288 (= D319), G289 (= G320), R292 (= R323), G311 (= G342), R312 (= R343)
- binding sulfate ion: Y23 (= Y35), W107 (≠ V119), R164 (= R175), H257 (= H288), R260 (= R291)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
33% identity, 96% coverage: 13:390/393 of query aligns to 2:360/360 of 2rduA
- active site: S106 (≠ T117), Y130 (= Y140), T156 (= T166), D158 (= D168), K234 (= K264), H258 (= H288)
- binding flavin mononucleotide: Y24 (= Y35), Y25 (≠ V36), A77 (≠ P88), T78 (= T89), A79 (≠ G90), S106 (≠ T117), Q128 (= Q138), Y130 (= Y140), T156 (= T166), K234 (= K264), H258 (= H288), G259 (= G289), R261 (= R291), D289 (= D319), G290 (= G320), G291 (= G321), R293 (= R323), G312 (= G342), R313 (= R343)
- binding glyoxylic acid: Y24 (= Y35), W108 (≠ V119), Y130 (= Y140), R165 (= R175), H258 (= H288), R261 (= R291)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
33% identity, 96% coverage: 13:390/393 of query aligns to 4:362/370 of Q9UJM8
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
33% identity, 96% coverage: 13:390/393 of query aligns to 4:362/362 of 6gmbA
- active site: Y132 (= Y140), D160 (= D168), H260 (= H288)
- binding flavin mononucleotide: Y26 (= Y35), Y27 (≠ V36), A79 (≠ P88), T80 (= T89), A81 (≠ G90), S108 (≠ T117), Q130 (= Q138), Y132 (= Y140), K236 (= K264), H260 (= H288), G261 (= G289), R263 (= R291), D291 (= D319), G292 (= G320), G293 (= G321), R295 (= R323), G314 (= G342), R315 (= R343)
- binding glycolic acid: Y26 (= Y35), W110 (≠ V119), Y132 (= Y140), R167 (= R175), H260 (= H288), R263 (= R291)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
33% identity, 96% coverage: 13:390/393 of query aligns to 1:353/353 of 5qieA
- active site: Y129 (= Y140), D157 (= D168), H251 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), Y24 (≠ V36), A76 (≠ P88), T77 (= T89), A78 (≠ G90), S105 (≠ T117), Q127 (= Q138), Y129 (= Y140), K227 (= K264), H251 (= H288), G252 (= G289), R254 (= R291), D282 (= D319), G283 (= G320), R286 (= R323), G305 (= G342), R306 (= R343)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: I3 (≠ Q15), D322 (≠ R359)
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
33% identity, 96% coverage: 13:390/393 of query aligns to 3:352/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y35), A80 (≠ G90), M81 (≠ F91), W109 (≠ V119), Y131 (= Y140), R166 (= R175), M182 (≠ F215), H250 (= H288), R253 (= R291)
- binding flavin mononucleotide: Y25 (= Y35), Y26 (≠ V36), A78 (≠ P88), T79 (= T89), A80 (≠ G90), S107 (≠ T117), W109 (≠ V119), Q129 (= Q138), Y131 (= Y140), T157 (= T166), K226 (= K264), H250 (= H288), G251 (= G289), R253 (= R291), D281 (= D319), G282 (= G320), R285 (= R323), G304 (= G342), R305 (= R343)
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
32% identity, 96% coverage: 13:390/393 of query aligns to 1:344/344 of 5qihA
- active site: Y129 (= Y140), D157 (= D168), H242 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), Y24 (≠ V36), A76 (≠ P88), T77 (= T89), A78 (≠ G90), S105 (≠ T117), Q127 (= Q138), Y129 (= Y140), K218 (= K264), H242 (= H288), G243 (= G289), R245 (= R291), D273 (= D319), G274 (= G320), R277 (= R323), G296 (= G342), R297 (= R343)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y35), A78 (≠ G90), M79 (≠ F91), W107 (≠ V119), Y129 (= Y140), M180 (≠ W190), L187 (≠ F212), H242 (= H288)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
32% identity, 96% coverage: 13:390/393 of query aligns to 1:344/344 of 5qidA
- active site: Y129 (= Y140), D157 (= D168), H242 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), Y24 (≠ V36), A76 (≠ P88), T77 (= T89), A78 (≠ G90), S105 (≠ T117), Q127 (= Q138), Y129 (= Y140), K218 (= K264), H242 (= H288), G243 (= G289), R245 (= R291), D273 (= D319), G274 (= G320), R277 (= R323), G296 (= G342), R297 (= R343)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ R69), E320 (≠ S366), R323 (≠ D369)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
32% identity, 96% coverage: 13:390/393 of query aligns to 1:344/344 of 5qicA
- active site: Y129 (= Y140), D157 (= D168), H242 (= H288)
- binding flavin mononucleotide: Y23 (= Y35), Y24 (≠ V36), A76 (≠ P88), T77 (= T89), A78 (≠ G90), S105 (≠ T117), Q127 (= Q138), Y129 (= Y140), K218 (= K264), H242 (= H288), G243 (= G289), R245 (= R291), D273 (= D319), G274 (= G320), R277 (= R323), G296 (= G342), R297 (= R343)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (= Y142), K132 (≠ R143), V136 (≠ F147), M180 (≠ W190), F183 (≠ Y208), Y190 (≠ I236), K193 (≠ Q239), A194 (≠ S240)
Query Sequence
>HSERO_RS01205 FitnessBrowser__HerbieS:HSERO_RS01205
LKRRLYAGADVQRAQSIEELRAMARKRVPNFCFEYVEGGAEEEISLRHNREVFTRIGFLP
RTLVDVSVRRQGRRLFGQDIASPFLIGPTGFSGLLAREGDVAMASAAASAGVPFVLTNVS
TTSLEEVVRRSGAQVWQQVYLYRDRAFVASVAQRAQAAGIGVLVLTTDSAVYGKREWDAR
NFSSPRRLDWRNKLDVLRHPRWLIDILYPHGFPRFANLGDLLPPDQTSVRGAAAAILGQS
LSAALDWADVQWLRGIWPGKLVLKGVMQVEDAQRAVALGVDGIVLSNHGGRQLDGALSTM
DVLPEVVAAVKGQLTVMLDGGFRRGADIVKAIALGADAVLLGRATTYGLAAGGQAGATRA
LEILRSEVDRVLALLACPDIDQLDASYLRRLQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory