Comparing HSERO_RS01260 FitnessBrowser__HerbieS:HSERO_RS01260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
34% identity, 36% coverage: 5:293/795 of query aligns to 26:312/314 of P00348
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
35% identity, 36% coverage: 5:293/795 of query aligns to 26:312/314 of Q16836
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
34% identity, 36% coverage: 5:293/795 of query aligns to 3:289/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
34% identity, 36% coverage: 5:293/795 of query aligns to 3:289/293 of 1f12A
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
34% identity, 36% coverage: 5:293/795 of query aligns to 3:289/291 of 1f0yA
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 36% coverage: 6:292/795 of query aligns to 5:284/286 of P9WNP7
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
34% identity, 36% coverage: 7:292/795 of query aligns to 1:277/281 of 6aa8E
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
31% identity, 36% coverage: 6:292/795 of query aligns to 1:278/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
31% identity, 36% coverage: 6:292/795 of query aligns to 1:278/280 of 4kuhA
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
33% identity, 36% coverage: 6:292/795 of query aligns to 2:279/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
33% identity, 36% coverage: 6:292/795 of query aligns to 2:279/283 of 4pzdA
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
29% identity, 36% coverage: 6:293/795 of query aligns to 332:613/726 of 8oqvA
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
29% identity, 36% coverage: 6:293/795 of query aligns to 328:609/723 of 8oqqA
Sites not aligning to the query:
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
29% identity, 36% coverage: 6:293/795 of query aligns to 328:609/723 of 8oqpA
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
29% identity, 36% coverage: 6:293/795 of query aligns to 316:597/711 of 7o4uA
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
29% identity, 36% coverage: 6:293/795 of query aligns to 334:615/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
29% identity, 36% coverage: 6:293/795 of query aligns to 335:616/730 of 8oquA
Sites not aligning to the query:
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
29% identity, 36% coverage: 6:293/795 of query aligns to 334:615/729 of 8oqtA
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
29% identity, 36% coverage: 6:293/795 of query aligns to 334:615/729 of 8oqnA
Sites not aligning to the query:
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
29% identity, 36% coverage: 6:293/795 of query aligns to 334:615/729 of 8opvA
Sites not aligning to the query:
>HSERO_RS01260 FitnessBrowser__HerbieS:HSERO_RS01260
VSNFIVKKVAVLGAGVMGAQIAAHCINARVPVVLFDLPAKEGPKNGIVQRAIENLKKLSP
APLGNKDDAALIQVANYEDDLAVLEGCDLIIEAIAERMDWKHDLYKKVAPHIGPKAIFAS
NTSGLSINALSEGFDAGLKARFCGVHFFNPPRYMHLVELIPTQSTEPHILDQLEAFLTTT
LGKGVVRAFDTPNFVANRVGVFGILATIIEAEKYGLSVDVVDDLTGAKLGRAKSGTFRTA
DVVGLDTMGHVIRTMQDNLKDDPFFSSYATPPLLAKLVEQGALGQKSGAGFYKKVGKDIL
RIDPAKGDYVPGGAKADDIIARILKEKDPVKRMKALHDSTNPQGQFLWAIFRDAFHYIAV
HLESVADNARDLDFAMRWGFGWSVGPFETWQAAGWKQIAQWVKEDIDAGKALSTAPLPDW
VFDGRDGVHSEKGSYSPSKKADVARSELPVYQRQAFRAPLVGEGAADGKSAGTTFFEDES
VRIWHQNDDVLILSFKTKMHVIGQGVIDGMNKAVSEAEQNFKGLVIWHPDAAEGGAFSAG
ADLQSMLPLFMSGGVKAIEPVVHQLQQAHQRLKYASVPVIAAVAGLALGGGCELLLHTAK
RVVSIESYIGLVEVGVGLIPAGGGLKEAAVRAAREAKGNDILPFLKEYMLAAATANVSKS
ALEARKLGYLREDDVIVFNPYELLHVAKVEARALFDAGYRPQLPPQVPVIGRNGLATIMA
QLVNMRDGGFISAHDFKLGKMIAETVSGGEVEEGSIVNEQWLLDIERKFFMELLNHPKTQ
ERIMGMMQTGKPVRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory