SitesBLAST
Comparing HSERO_RS01275 FitnessBrowser__HerbieS:HSERO_RS01275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 85% coverage: 28:389/425 of query aligns to 3:349/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ V32), G8 (= G33), G10 (= G35), V11 (≠ I36), I12 (≠ T37), V30 (≠ C55), E31 (= E56), K32 (≠ A57), E38 (≠ A63), A39 (= A64), S40 (= S65), A43 (≠ N68), G45 (= G70), L46 (≠ M71), V171 (= V207), G200 (≠ S235), G201 (= G236), W203 (≠ S238), G298 (= G341), R300 (≠ V343), P301 (≠ D344), Y326 (≠ S366), R327 (≠ G367), N328 (≠ H368), G329 (= G369), I330 (≠ T370)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
27% identity, 49% coverage: 187:393/425 of query aligns to 154:355/369 of S5FMM4
- S202 (= S235) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ T370) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (= M380) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 88% coverage: 27:398/425 of query aligns to 6:391/824 of 4pabB
- active site: T53 (≠ L83), E102 (≠ K136), H226 (≠ A255), Y255 (≠ F288)
- binding flavin-adenine dinucleotide: I11 (≠ V32), G12 (= G33), G14 (= G35), C15 (≠ I36), V16 (≠ T37), L35 (≠ C55), E36 (= E56), K37 (≠ A57), G43 (≠ A63), S44 (≠ A64), T45 (≠ S65), H47 (≠ R67), A48 (≠ N68), A49 (≠ G69), G50 (= G70), L51 (≠ M71), V175 (= V207), A204 (≠ S235), G205 (= G236), W207 (vs. gap), H226 (≠ A255), Y228 (≠ L257), G326 (= G341), I328 (≠ V343), F353 (≠ Y365), Y355 (≠ H368), G356 (= G369), I357 (≠ T370), I358 (≠ H371)
Sites not aligning to the query:
- active site: 536
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 88% coverage: 27:398/425 of query aligns to 43:428/857 of Q63342
- CV 52:53 (≠ IT 36:37) binding
- EK 73:74 (≠ EA 56:57) binding
- 80:88 (vs. 63:71, 11% identical) binding
- H84 (≠ R67) modified: Tele-8alpha-FAD histidine
- V212 (= V207) binding
- W244 (vs. gap) binding
- F-GYGII 390:395 (≠ YSGHGTH 365:371) binding
Sites not aligning to the query:
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
25% identity, 81% coverage: 23:365/425 of query aligns to 16:351/403 of 2gagB
- active site: A61 (≠ G66), T64 (≠ G69), T65 (≠ G70)
- binding flavin-adenine dinucleotide: G26 (= G33), G28 (= G35), G29 (≠ I36), H30 (≠ T37), E51 (= E56), K52 (≠ A57), G58 (≠ A63), N59 (≠ A64), M60 (≠ S65), R62 (= R67), N63 (= N68), T64 (≠ G69), I66 (≠ M71), V195 (= V207), G224 (vs. gap), A225 (≠ S235), H227 (≠ I237), L231 (≠ I250), L246 (vs. gap)
- binding flavin mononucleotide: A61 (≠ G66), R62 (= R67), H171 (≠ G184), V250 (≠ L268), E278 (≠ L296), R321 (≠ Y337), W323 (= W339)
- binding 2-furoic acid: T64 (≠ G69), I66 (≠ M71), R68 (≠ N73), M263 (≠ T281), Y270 (≠ F288)
- binding sulfite ion: K170 (≠ V183), K276 (≠ Q294)
Sites not aligning to the query:
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
23% identity, 83% coverage: 45:398/425 of query aligns to 23:355/364 of 3if9A
- active site: A47 (≠ G69), G48 (= G70), M49 (= M71)
- binding flavin-adenine dinucleotide: E34 (= E56), S35 (≠ A57), T42 (≠ A64), T43 (≠ S65), A46 (≠ N68), A47 (≠ G69), G48 (= G70), M49 (= M71), P173 (= P206), V174 (= V207), S202 (= S235), G203 (= G236), W205 (≠ S238), F209 (≠ I246), G300 (= G341), R302 (≠ V343), H327 (≠ Y365), F328 (≠ S366), R329 (≠ G367), N330 (≠ H368), G331 (= G369), I332 (≠ T370)
- binding glycolic acid: Y246 (= Y287), R302 (≠ V343), R329 (≠ G367)
Sites not aligning to the query:
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
23% identity, 83% coverage: 45:398/425 of query aligns to 23:355/369 of O31616
- ES 34:35 (≠ EA 56:57) binding
- TT 42:43 (≠ AS 64:65) binding
- AGM 47:49 (≠ GGM 69:71) binding
- G51 (vs. gap) mutation to R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; mutation to S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- A54 (vs. gap) mutation to R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- V174 (= V207) binding
- H244 (≠ T281) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ V343) binding
- 327:333 (vs. 365:371, 14% identical) binding
- R329 (≠ G367) binding
Sites not aligning to the query:
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
25% identity, 79% coverage: 15:351/425 of query aligns to 13:331/383 of 5i39A
- active site: F66 (≠ N68), Q69 (≠ M71), A70 (≠ C72), Q248 (≠ L267), P267 (≠ N283)
- binding flavin-adenine dinucleotide: V30 (= V32), G31 (= G33), G33 (= G35), I34 (= I36), L35 (≠ T37), V53 (≠ C55), E54 (= E56), K55 (≠ A57), Q62 (≠ A64), S63 (= S65), F66 (≠ N68), Y67 (≠ G69), Q69 (≠ M71), A196 (≠ P206), A197 (≠ V207), G226 (≠ S235), G227 (= G236), W229 (= W245), Q248 (≠ L267), Q250 (≠ K269), G321 (= G341), M323 (≠ V343)
Sites not aligning to the query:
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
23% identity, 83% coverage: 45:398/425 of query aligns to 23:355/364 of 1ng3A
- active site: A47 (≠ G69), G48 (= G70), M49 (= M71)
- binding acetylamino-acetic acid: Y246 (= Y287), R302 (≠ V343), R329 (≠ G367)
- binding flavin-adenine dinucleotide: F33 (≠ C55), E34 (= E56), S35 (≠ A57), R41 (≠ A63), T42 (≠ A64), T43 (≠ S65), A46 (≠ N68), A47 (≠ G69), G48 (= G70), M49 (= M71), V174 (= V207), S202 (= S235), G203 (= G236), W205 (≠ S238), F209 (≠ I246), G300 (= G341), R302 (≠ V343), H327 (≠ Y365), R329 (≠ G367), N330 (≠ H368), G331 (= G369), I332 (≠ T370)
- binding phosphate ion: R89 (= R111), R254 (= R295)
Sites not aligning to the query:
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
23% identity, 83% coverage: 29:382/425 of query aligns to 28:381/824 of Q8GAI3
- W66 (≠ G66) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R67) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
26% identity, 52% coverage: 15:237/425 of query aligns to 5:220/433 of 5hxwA
- active site: F58 (≠ N68), Q61 (≠ M71), A62 (≠ C72)
- binding flavin-adenine dinucleotide: V22 (= V32), G23 (= G33), G25 (= G35), I26 (= I36), L27 (≠ T37), E46 (= E56), K47 (≠ A57), E53 (≠ A63), Q54 (≠ A64), S55 (= S65), R57 (= R67), F58 (≠ N68), Y59 (≠ G69), G60 (= G70), Q61 (≠ M71), A188 (≠ P206), A189 (≠ V207), G218 (≠ S235), G219 (= G236)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
26% identity, 61% coverage: 107:365/425 of query aligns to 90:353/405 of P40875
- C146 (vs. gap) mutation to S: No change in activity.
- H173 (≠ G184) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ Y186) mutation to A: No effect on FMN binding and activity.
- C195 (≠ T205) mutation to S: No change in activity.
- C351 (≠ M363) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
Query Sequence
>HSERO_RS01275 FitnessBrowser__HerbieS:HSERO_RS01275
MMQLKSYWLDTSPAFVSQTQTLPEGACDVVVVGGGITGSAAALALARKGARVVVCEADIV
GGAASGRNGGMCNNGFAQDYATLSQRLGVEWANRLYRAFDAGVDTVERLVREESIDCSFA
RHGKLKLAAKPEHVDKLARSQELLARHVDGDTRLLSRAQLRDELGSDRYHGGLLMHKSAG
MHVGRYVRGLAQAAQRRGALYLERTPVLGIEAKNGRYAVRTSAGVLHAGQVLLASGISQV
GPFGWIRRRIVPVGAFLIVTEPLPGALLKQLLPTQRMYTDTKNFVNYFRATPDQRLLFGG
RARFAASNPQSDARSGEILRAQMLEVFPALAQTRIDYCWGGMVDMTTDRLPRAGQRDGLY
YSMGYSGHGTHMATLMGSMMAEIMDGHAELNPWKDFDWPAIPGHFGKPWFLPFVGAWYRL
KDRLQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory