Comparing HSERO_RS01300 FitnessBrowser__HerbieS:HSERO_RS01300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
41% identity, 73% coverage: 74:305/319 of query aligns to 56:284/285 of 3uf6A
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
41% identity, 73% coverage: 74:305/319 of query aligns to 58:286/288 of 3u9eB
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 95% coverage: 9:310/319 of query aligns to 389:713/714 of Q8ZND6
Sites not aligning to the query:
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
25% identity, 75% coverage: 50:289/319 of query aligns to 43:307/325 of 1xcoD
6zngF Maeb full-length acetyl-coa bound state (see paper)
22% identity, 82% coverage: 20:280/319 of query aligns to 432:717/753 of 6zngF
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
26% identity, 79% coverage: 39:291/319 of query aligns to 29:312/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
26% identity, 79% coverage: 39:291/319 of query aligns to 30:313/333 of P38503
Sites not aligning to the query:
>HSERO_RS01300 FitnessBrowser__HerbieS:HSERO_RS01300
MLQSVQATPAERYDQLIRDALGAQAMRVAVVHPCSPEALQGALEARDEGLFDPVLVGPET
RIRRIAEAADISLQGLPIVPAEHSHAAAARAVEMAVAGEVGALMKGSLHSDELLGAVVGG
ASGLRTERRISHVYAMAIPAYPKPLIITDAAINIAPTLAHKRDICQNAIDLLHVMGVPRP
HVAVLAAVETVNPAMPSTLDAAALTVMATRHQITGALVDGPLAFDNAISLQAASVKGIVS
PVAGSADILLVPDLEAGNMLAKQLIYLSQADAAGLVLGARVPIILTSRADSLRVRLASSA
LARLVASRQRLQSADRELA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory