Comparing HSERO_RS01340 HSERO_RS01340 sugar ABC transporter permease to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
31% identity, 83% coverage: 34:292/311 of query aligns to 6:265/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
30% identity, 89% coverage: 11:288/311 of query aligns to 11:288/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
26% identity, 64% coverage: 99:297/311 of query aligns to 271:483/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
25% identity, 66% coverage: 99:304/311 of query aligns to 286:507/514 of P02916
>HSERO_RS01340 HSERO_RS01340 sugar ABC transporter permease
MLAPTSAAQPPAPPAAATVATTAASGPQRSAARRNRAAFWFLAPACVMTLVYVLYPILYT
IYLSFFSWDGMTEPRFVGLANYVELFHAPTFYTALKNNVLWLLMFLLAPPMGLAIALYLN
QKVIGMRVVKSLFFAPFVLSGVVVGLMYSWFYDPSFGLLSLLFGQGVPVLGDARYATFGI
IFAALWPQTAYCMILFLTGLTALNHDQVEAARMEGAKGWTMLRYVILPQLRSTTFMAFVV
SIIGALRSFDLISVMTSGGPYESSTVLAYYAYDQAIKYYRQGYSAAVAVTLFAIMLVYIV
YQLRRMLRAER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory