Comparing HSERO_RS01350 FitnessBrowser__HerbieS:HSERO_RS01350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O69315 Beta-galactosidase; Beta-gal; Lactase; EC 3.2.1.23 from Thermus thermophilus (see paper)
54% identity, 98% coverage: 5:652/658 of query aligns to 2:642/645 of O69315
1kwkA Crystal structure of thermus thermophilus a4 beta-galactosidase in complex with galactose (see paper)
54% identity, 98% coverage: 5:652/658 of query aligns to 2:642/644 of 1kwkA
1kwgA Crystal structure of thermus thermophilus a4 beta-galactosidase (see paper)
54% identity, 98% coverage: 5:652/658 of query aligns to 2:642/644 of 1kwgA
6lvwA Polyextremophilic beta-galactosidase from the antarctic haloarchaeon halorubrum lacusprofundi (see paper)
41% identity, 99% coverage: 3:651/658 of query aligns to 1:658/668 of 6lvwA
3ttyA Crystal structure of beta-galactosidase from bacillus circulans sp. Alkalophilus in complex with galactose (see paper)
27% identity, 98% coverage: 9:651/658 of query aligns to 15:671/675 of 3ttyA
3ttsA Crystal structure of beta-galactosidase from bacillus circulans sp. Alkalophilus (see paper)
27% identity, 98% coverage: 9:651/658 of query aligns to 15:671/675 of 3ttsA
5e9aB Crystal structure analysis of the cold-adamped beta-galactosidase from rahnella sp. R3 (see paper)
30% identity, 95% coverage: 6:631/658 of query aligns to 16:655/684 of 5e9aB
5dfaA 3d structure of the e323a catalytic mutant of gan42b, a gh42 beta- galactosidase from g. Stearothermophilus (see paper)
28% identity, 98% coverage: 6:651/658 of query aligns to 17:680/685 of 5dfaA
4ucfA Crystal structure of bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose (see paper)
27% identity, 99% coverage: 3:653/658 of query aligns to 17:681/682 of 4ucfA
Sites not aligning to the query:
4uzsA Crystal structure of bifidobacterium bifidum beta-galactosidase (see paper)
30% identity, 78% coverage: 3:518/658 of query aligns to 18:526/687 of 4uzsA
Sites not aligning to the query:
4uniA Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. Lactis bl-04 in complex with galactose (see paper)
27% identity, 99% coverage: 5:653/658 of query aligns to 19:688/689 of 4uniA
4uozA Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. Lactis bl-04 nucleophile mutant e324a in complex with galactose (see paper)
27% identity, 99% coverage: 5:653/658 of query aligns to 18:687/688 of 4uozA
8ibtA Crystal structure of gh42 beta-galactosidase bibga42a from bifidobacterium longum subspecies infantis e318s mutant in complex with lacto-n-tetraose (see paper)
27% identity, 98% coverage: 6:653/658 of query aligns to 22:688/694 of 8ibtA
8ibsA Crystal structure of gh42 beta-galactosidase bibga42a from bifidobacterium longum subspecies infantis e160a/e318a mutant in complex with galactose (see paper)
27% identity, 98% coverage: 6:653/658 of query aligns to 22:690/691 of 8ibsA
O31529 Beta-galactosidase YesZ; Beta-gal; Probable rhamnogalacturonan beta-galactosidase; EC 3.2.1.23 from Bacillus subtilis (strain 168) (see paper)
25% identity, 95% coverage: 6:632/658 of query aligns to 7:632/663 of O31529
7vkxA The complex structure of beta-1,2-glucosyltransferase from ignavibacterium album with glucose (see paper)
22% identity, 25% coverage: 80:244/658 of query aligns to 104:270/702 of 7vkxA
Sites not aligning to the query:
7vl7A The complex structure of beta-1,2-glucosyltransferase from ignavibacterium album with esculin (see paper)
22% identity, 25% coverage: 80:244/658 of query aligns to 104:270/706 of 7vl7A
Sites not aligning to the query:
7vl6A The complex structure of beta-1,2-glucosyltransferase from ignavibacterium album with arbutin (see paper)
22% identity, 25% coverage: 80:244/658 of query aligns to 104:270/706 of 7vl6A
Sites not aligning to the query:
7vl2A The complex structure of beta-1,2-glucosyltransferase from ignavibacterium album with ethyl alpha-d-glucoside (see paper)
22% identity, 25% coverage: 80:244/658 of query aligns to 104:270/706 of 7vl2A
Sites not aligning to the query:
7vl1A The complex structure of beta-1,2-glucosyltransferase from ignavibacterium album with methyl alpha-d-glucoside (see paper)
22% identity, 25% coverage: 80:244/658 of query aligns to 104:270/706 of 7vl1A
Sites not aligning to the query:
>HSERO_RS01350 FitnessBrowser__HerbieS:HSERO_RS01350
MSLRLGVCYYPEHWPEAMWDSDAQRMKALGIKQVRIGEFAWSRIEPSPGELRWDWLDRAI
EVLARHGLEVVMCTPTATPPKWLIDRHDDVLAVDANGRQRAFGSRRHYDFSSDSYFEESQ
RIVRLLGERYGQHPAVTAWQTDNEYGCHQTVVSYSASAQRRFRQWLRQRYGSIDALNTAW
GTVFWSMEYRSFDEIDAPIGTVTEAHPSHRLDYRRFASDEVARYNRMQVEILRALSPGRL
MVHNFMQMFLEFDHYPVAADLDVATWDSYPLGALEVMWFDDATKARWLRTGHPDFASFNH
DLYRGMSAQPFWVMEQQPGPVNWAHWNPHPLPGMVRLWSWEAFAHGAGCVSYFRWRQCPF
AQEQLHAGLNRPDNRLDVGGSEAEQVAREIITVEQAQGALAQPRGKVALLFDYDAKWLFD
IHFQGIDFEYQRFAFQYYATLRALGLDVDILPLHAKLDGYAMIVVPPLPIVPDDLPGRIA
ESGALSVFGPRSGSKTRSLQIPATLPPGPLQQLLPMRVWRVESLRPNVTEPVQFGAHSGQ
GAHWRDLIEADGEGLQTLAQFGDGHPAIVRKERAHYLAGIFDDALTSACFEQLARDAGLA
PQRLPEGLRLQERGGLCFAFNYSDAAITLPQAQGAQFLVGQAQLEPQGVAVYRTGQHP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory