SitesBLAST
Comparing HSERO_RS01605 FitnessBrowser__HerbieS:HSERO_RS01605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 41% coverage: 245:417/421 of query aligns to 197:363/368 of 4yshB
- active site: I262 (≠ V315), L283 (= L336), G305 (= G360), N335 (≠ L389), L338 (≠ T392)
- binding flavin-adenine dinucleotide: S206 (≠ L254), W209 (≠ D257), R307 (= R362), H332 (≠ Q386), R334 (≠ A388), N335 (≠ L389), G336 (= G390), I337 (≠ W391), L338 (≠ T392)
- binding glycine: G249 (≠ I304), Y251 (= Y306), Y251 (= Y306), A264 (≠ G317), R307 (= R362), R334 (≠ A388), R334 (≠ A388)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48, 178
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 41% coverage: 245:417/421 of query aligns to 197:363/370 of 4yshA
- active site: I262 (≠ V315), L283 (= L336), G305 (= G360), N335 (≠ L389), L338 (≠ T392)
- binding flavin-adenine dinucleotide: S206 (≠ L254), G207 (= G255), W209 (≠ D257), R307 (= R362), H332 (≠ Q386), R334 (≠ A388), N335 (≠ L389), G336 (= G390), I337 (≠ W391)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48, 178
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
27% identity, 41% coverage: 245:417/421 of query aligns to 199:365/377 of Q5L2C2
- R309 (= R362) binding
- 334:340 (vs. 386:392, 14% identical) binding
- R336 (≠ A388) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 180 binding
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
24% identity, 84% coverage: 67:421/421 of query aligns to 36:389/403 of 2gagB
- active site: A61 (≠ Y95), T64 (≠ A98), T65 (≠ G99)
- binding flavin-adenine dinucleotide: E51 (= E82), K52 (≠ A83), G58 (≠ F92), N59 (≠ L93), M60 (≠ R94), R62 (≠ C96), N63 (= N97), T64 (≠ A98), I66 (≠ S100), V195 (≠ I225), G224 (≠ L254), A225 (≠ G255), H227 (≠ D257), L231 (≠ F261), L246 (= L274), G352 (= G387), T353 (≠ A388), G354 (≠ L389), G355 (= G390), F356 (≠ W391), K357 (≠ T392)
- binding flavin mononucleotide: A61 (≠ Y95), R62 (≠ C96), H171 (≠ A202), V250 (≠ E284), E278 (≠ Q311), R321 (≠ S356), W323 (= W358)
- binding 2-furoic acid: T64 (≠ A98), I66 (≠ S100), R68 (= R102), M263 (≠ I297), Y270 (≠ K303), K357 (≠ T392)
- binding sulfite ion: K170 (≠ P201), K276 (≠ L309)
Sites not aligning to the query:
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
25% identity, 48% coverage: 219:421/421 of query aligns to 191:391/405 of P40875
- C195 (≠ A223) mutation to S: No change in activity.
- C351 (≠ I384) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 146 C→S: No change in activity.
- 173 modified: Tele-8alpha-FMN histidine; H→N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- 175 H→A: No effect on FMN binding and activity.
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
25% identity, 48% coverage: 219:421/421 of query aligns to 190:390/404 of 3ad8B
- active site: G326 (= G360), K358 (≠ T392)
- binding flavin-adenine dinucleotide: V196 (≠ I225), G225 (≠ L254), A226 (≠ G255), H228 (≠ D257), L247 (= L274), G353 (= G387), T354 (≠ A388), G355 (≠ L389), G356 (= G390), F357 (≠ W391), K358 (≠ T392)
- binding flavin mononucleotide: V251 (≠ E284), E279 (≠ Q311), R322 (≠ S356), W324 (= W358)
- binding pyrrole-2-carboxylate: M264 (≠ I297), Y271 (≠ K303), T354 (≠ A388), K358 (≠ T392)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
25% identity, 48% coverage: 219:421/421 of query aligns to 190:390/404 of 3ad7B
- active site: G326 (= G360), K358 (≠ T392)
- binding flavin-adenine dinucleotide: V196 (≠ I225), G225 (≠ L254), A226 (≠ G255), H228 (≠ D257), L247 (= L274), G353 (= G387), T354 (≠ A388), G355 (≠ L389), G356 (= G390), F357 (≠ W391), K358 (≠ T392)
- binding flavin mononucleotide: V251 (≠ E284), K277 (≠ L309), E279 (≠ Q311), R322 (≠ S356), W324 (= W358)
- binding [methylthio]acetate: M264 (≠ I297), Y271 (≠ K303), T354 (≠ A388), K358 (≠ T392)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding [methylthio]acetate: 67, 69, 402
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
25% identity, 48% coverage: 219:421/421 of query aligns to 190:390/402 of 1vrqB
- active site: G326 (= G360), K358 (≠ T392)
- binding n,n-dimethylglycine: K358 (≠ T392)
- binding flavin-adenine dinucleotide: V196 (≠ I225), A224 (= A253), G225 (≠ L254), H228 (≠ D257), L247 (= L274), G353 (= G387), T354 (≠ A388), G355 (≠ L389), G356 (= G390), F357 (≠ W391), K358 (≠ T392)
- binding flavin mononucleotide: V251 (≠ E284), E279 (≠ Q311), R322 (≠ S356), W324 (= W358)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
25% identity, 48% coverage: 219:421/421 of query aligns to 191:391/405 of Q50LF2
- V197 (≠ I225) binding
- H270 (≠ A301) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ K303) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G387) binding
- G357 (= G390) binding
- K359 (≠ T392) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
- 172 K→A: Retains 39% of wild-type activity.; K→D: Retains 32% of wild-type activity.; K→R: Retains 58% of wild-type activity.
- 173 modified: Tele-8alpha-FMN histidine
6j39A Crystal structure of cmis2 with inhibitor (see paper)
26% identity, 71% coverage: 107:405/421 of query aligns to 57:351/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (vs. gap), Y252 (≠ I304), Y267 (≠ I319), R308 (= R362), R334 (≠ A388), I335 (≠ L389)
- binding flavin-adenine dinucleotide: A174 (≠ G232), A203 (≠ L254), W206 (≠ D257), I228 (≠ S278), Y252 (≠ I304), R308 (= R362), S333 (≠ G387), R334 (≠ A388), I335 (≠ L389), G336 (= G390), V337 (≠ W391), Q338 (≠ T392)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
26% identity, 71% coverage: 107:405/421 of query aligns to 57:351/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (≠ G232), A203 (≠ L254), W206 (≠ D257), G226 (= G276), G306 (= G360), R308 (= R362), S333 (≠ G387), R334 (≠ A388), I335 (≠ L389), G336 (= G390), V337 (≠ W391), Q338 (≠ T392)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
Query Sequence
>HSERO_RS01605 FitnessBrowser__HerbieS:HSERO_RS01605
MHICVMGAGVIGVTTAYRLLQDGHQVSLIDERDQPGAGTSQGNGAQLSYSYVAPLADPSV
WSKWAYYLFSKDSPLTIKPTLEAAQYRWLAGFLRYCNAGSVRQTTIDLLQLAFYSRDQLT
QWNGRLKLSFDHQRSGKLVMFTDAQGLEAAAGQVRFQAQYGCQQEVLDAAQCIRIEPALG
RSQRDWVGGVYTRSEEAGDCPAFCRALVAAMQADPNFRFIGGARITAVRRQGSALSAVQA
GNEWISAQRFVLALGADSADFARQLDLRLPLYPLKGYSITVPLEDEASRAAAPQVSITDI
ARKIVYARLGQRLRVAGRIELVGQDRSIPPRAIAELKQGMRELFPDCVLGEDARLSPWMG
FRPATPSGVPIVGACPVDNLYLNIGQGALGWTLACGSAALIADQIAGRPCSIDDTPFRYR
T
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory