SitesBLAST
Comparing HSERO_RS01865 FitnessBrowser__HerbieS:HSERO_RS01865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
45% identity, 76% coverage: 10:214/269 of query aligns to 3:206/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
45% identity, 76% coverage: 10:214/269 of query aligns to 3:206/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F19), S37 (= S48), G38 (= G49), C39 (= C50), G40 (= G51), K41 (= K52), S42 (= S53), T43 (= T54), Q81 (= Q89), R128 (= R136), A132 (≠ D140), S134 (= S142), G136 (= G144), Q137 (≠ M145), E158 (= E166), H191 (= H199)
- binding magnesium ion: S42 (= S53), Q81 (= Q89)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
45% identity, 76% coverage: 10:214/269 of query aligns to 3:206/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F19), G38 (= G49), C39 (= C50), G40 (= G51), K41 (= K52), S42 (= S53), T43 (= T54), R128 (= R136), S134 (= S142), Q137 (≠ M145)
- binding beryllium trifluoride ion: S37 (= S48), G38 (= G49), K41 (= K52), Q81 (= Q89), S134 (= S142), G136 (= G144), H191 (= H199)
- binding magnesium ion: S42 (= S53), Q81 (= Q89)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
45% identity, 76% coverage: 10:214/269 of query aligns to 3:206/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F19), V17 (≠ A28), G38 (= G49), C39 (= C50), G40 (= G51), K41 (= K52), S42 (= S53), T43 (= T54), R128 (= R136), A132 (≠ D140), S134 (= S142), Q137 (≠ M145)
- binding tetrafluoroaluminate ion: S37 (= S48), G38 (= G49), K41 (= K52), Q81 (= Q89), S134 (= S142), G135 (= G143), G136 (= G144), E158 (= E166), H191 (= H199)
- binding magnesium ion: S42 (= S53), Q81 (= Q89)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
45% identity, 76% coverage: 10:214/269 of query aligns to 3:206/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F19), V17 (≠ A28), G38 (= G49), C39 (= C50), G40 (= G51), K41 (= K52), S42 (= S53), T43 (= T54), R128 (= R136), A132 (≠ D140), S134 (= S142), Q137 (≠ M145)
- binding magnesium ion: S42 (= S53), Q81 (= Q89)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
45% identity, 76% coverage: 10:214/269 of query aligns to 1:204/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F19), S35 (= S48), G36 (= G49), C37 (= C50), G38 (= G51), K39 (= K52), S40 (= S53), T41 (= T54), R126 (= R136), A130 (≠ D140), S132 (= S142), G134 (= G144), Q135 (≠ M145)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
45% identity, 76% coverage: 10:214/269 of query aligns to 4:207/371 of P68187
- A85 (= A92) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P113) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V121) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ L124) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D126) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ I131) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G144) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D165) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1g291 Malk (see paper)
44% identity, 77% coverage: 10:215/269 of query aligns to 4:214/372 of 1g291
- binding magnesium ion: D69 (≠ E79), E71 (≠ G81), K72 (≠ P82), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S48), G39 (= G49), C40 (= C50), G41 (= G51), K42 (= K52), T43 (≠ S53), T44 (= T54)
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
44% identity, 70% coverage: 27:214/269 of query aligns to 40:236/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39
7aheC Opua inhibited inward facing (see paper)
44% identity, 70% coverage: 27:214/269 of query aligns to 40:236/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
45% identity, 82% coverage: 4:224/269 of query aligns to 12:229/378 of P69874
- C26 (≠ V18) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F19) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F41) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C50) mutation to T: Loss of ATPase activity and transport.
- L60 (= L56) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ T72) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ L128) mutation to M: Loss of ATPase activity and transport.
- D172 (= D165) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
7ahdC Opua (e190q) occluded (see paper)
43% identity, 70% coverage: 26:214/269 of query aligns to 39:236/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ V26), S61 (= S48), G62 (= G49), G64 (= G51), K65 (= K52), S66 (= S53), T67 (= T54), Q111 (= Q89), K161 (= K139), Q162 (≠ D140), S164 (= S142), G166 (= G144), M167 (= M145), Q188 (≠ E166), H221 (= H199)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
45% identity, 71% coverage: 25:215/269 of query aligns to 18:217/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 71% coverage: 25:214/269 of query aligns to 15:207/369 of P19566
- L86 (= L93) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P167) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D172) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
8hplC Lpqy-sugabc in state 1 (see paper)
46% identity, 70% coverage: 28:214/269 of query aligns to 16:205/384 of 8hplC
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
46% identity, 70% coverage: 28:214/269 of query aligns to 18:207/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S48), G39 (= G49), G41 (= G51), K42 (= K52), S43 (= S53), Q82 (= Q89), Q133 (≠ D140), G136 (= G143), G137 (= G144), Q138 (≠ M145), H192 (= H199)
- binding magnesium ion: S43 (= S53), Q82 (= Q89)
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
46% identity, 70% coverage: 28:214/269 of query aligns to 18:207/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S48), C40 (= C50), G41 (= G51), K42 (= K52), S43 (= S53), T44 (= T54), Q82 (= Q89), R129 (= R136), Q133 (≠ D140), S135 (= S142), G136 (= G143), G137 (= G144), Q159 (≠ E166), H192 (= H199)
- binding magnesium ion: S43 (= S53), Q82 (= Q89)
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 70% coverage: 28:214/269 of query aligns to 19:208/393 of P9WQI3
- H193 (= H199) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
45% identity, 71% coverage: 24:214/269 of query aligns to 6:176/344 of 2awnC
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 77% coverage: 9:215/269 of query aligns to 3:215/353 of 1oxvD
Query Sequence
>HSERO_RS01865 FitnessBrowser__HerbieS:HSERO_RS01865
MNQTNASPRIRIQGVHKVFKTDDREVVALKDINLDIPDGQFVCLLGPSGCGKSTLLNAIA
GFALPSSGQILTDDKVVSEPGPDRGMVFQEYALFPWMTVEQNVAFGLEIKGTPKAEIHQR
VTQLLDKLGLIDFRTRFPKDLSGGMRQRVAIARVLALDSPIMLMDEPFGALDALTRRNLQ
DELLRIWDEFRKTIVFVTHSIEEAIYLADRIVVMTYRPGTVKRDMLVNLPRLRDPADPEF
NALKRELGQLVMEEQQRHHNAEMKAAAVD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory