Comparing HSERO_RS02035 FitnessBrowser__HerbieS:HSERO_RS02035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
32% identity, 95% coverage: 2:205/214 of query aligns to 2:202/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
32% identity, 95% coverage: 2:205/214 of query aligns to 2:202/207 of 1h2eA
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
32% identity, 87% coverage: 4:189/214 of query aligns to 4:195/209 of 4qihA
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
39% identity, 49% coverage: 4:108/214 of query aligns to 6:110/223 of P9WIC7
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
39% identity, 49% coverage: 4:108/214 of query aligns to 5:109/217 of 4pzaB
Sites not aligning to the query:
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
25% identity, 95% coverage: 1:204/214 of query aligns to 1:200/207 of 4ij6A
P9WIC9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 78% coverage: 3:169/214 of query aligns to 6:198/249 of P9WIC9
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
26% identity, 72% coverage: 1:155/214 of query aligns to 1:147/196 of 6m1xC
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
30% identity, 79% coverage: 1:169/214 of query aligns to 3:199/250 of P62707
Sites not aligning to the query:
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
30% identity, 79% coverage: 1:169/214 of query aligns to 1:197/239 of 1e59A
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
32% identity, 64% coverage: 4:141/214 of query aligns to 6:144/257 of Q7ZVE3
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
25% identity, 72% coverage: 1:155/214 of query aligns to 1:147/198 of 5zr2C
O60825 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see 2 papers)
30% identity, 74% coverage: 4:161/214 of query aligns to 252:398/505 of O60825
Sites not aligning to the query:
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
30% identity, 74% coverage: 4:161/214 of query aligns to 222:368/425 of 5htkA
Sites not aligning to the query:
P26285 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Bos taurus (Bovine) (see paper)
30% identity, 74% coverage: 4:161/214 of query aligns to 253:399/531 of P26285
Sites not aligning to the query:
5hr5A Bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
30% identity, 74% coverage: 4:161/214 of query aligns to 226:372/424 of 5hr5A
Sites not aligning to the query:
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 74% coverage: 4:161/214 of query aligns to 10:170/211 of P36623
3gp3A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine (see paper)
36% identity, 48% coverage: 1:102/214 of query aligns to 1:107/229 of 3gp3A
Sites not aligning to the query:
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
36% identity, 48% coverage: 1:102/214 of query aligns to 1:107/230 of 3fdzA
Sites not aligning to the query:
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
36% identity, 48% coverage: 1:102/214 of query aligns to 1:107/248 of 3gp5A
Sites not aligning to the query:
>HSERO_RS02035 FitnessBrowser__HerbieS:HSERO_RS02035
MTEILLIRHGETDWNVDKRLQGHIDIGLNAAGQRQVLALGEALAAEGIDAVFASDLQRAR
DTAQAVAGTAGLTVQIDAGLRERCYGAFEGLRHSEIEARYPDAYRQWKARDPDFRYPAGE
RVAETMREFYERSVQAMQRVLASGRYGKVAIVTHGGVLECVHHWASQTSFAQPRTFDIFN
ASVNRLHWDGQRAHIRSWGEIGHLQRETLDEVDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory