Comparing HSERO_RS02130 FitnessBrowser__HerbieS:HSERO_RS02130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
O31618 Thiazole synthase; EC 2.8.1.10 from Bacillus subtilis (strain 168) (see 2 papers)
54% identity, 94% coverage: 15:266/269 of query aligns to 4:253/256 of O31618
1tygA Structure of the thiazole synthase/this complex (see paper)
54% identity, 90% coverage: 15:255/269 of query aligns to 2:240/242 of 1tygA
5z9yB Crystal structure of mycobacterium tuberculosis thiazole synthase (thig) complexed with dxp (see paper)
52% identity, 91% coverage: 15:259/269 of query aligns to 2:233/234 of 5z9yB
4n6fA Crystal structure of amycolatopsis orientalis bexx complexed with g6p (see paper)
34% identity, 90% coverage: 11:253/269 of query aligns to 1:240/242 of 4n6fA
Q8L940 Pyridoxal 5'-phosphate synthase subunit PDX1.3; AtPDX1.3; AtPDX1;1; PLP synthase subunit PDX1.3; EC 4.3.3.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
45% identity, 23% coverage: 180:240/269 of query aligns to 208:271/309 of Q8L940
Sites not aligning to the query:
5k2zB Pdx1.3-adduct (arabidopsis) (see paper)
45% identity, 23% coverage: 180:240/269 of query aligns to 189:252/278 of 5k2zB
Sites not aligning to the query:
5lnrA Crystal structure of arabidopsis thaliana pdx1-plp complex (see paper)
45% identity, 23% coverage: 180:240/269 of query aligns to 188:251/267 of 5lnrA
Sites not aligning to the query:
5lnuA Crystal structure of arabidopsis thaliana pdx1-i320 complex (see paper)
45% identity, 23% coverage: 180:240/269 of query aligns to 188:251/277 of 5lnuA
Sites not aligning to the query:
5lnwA Crystal structure of arabidopsis thaliana pdx1-i320-g3p complex (see paper)
45% identity, 23% coverage: 180:240/269 of query aligns to 188:251/274 of 5lnwA
Sites not aligning to the query:
Q9WYU4 Pyridoxal 5'-phosphate synthase subunit PdxS; PLP synthase subunit PdxS; Pdx1; EC 4.3.3.6 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
34% identity, 42% coverage: 154:266/269 of query aligns to 167:278/293 of Q9WYU4
Sites not aligning to the query:
5lnsA Crystal structure of arabidopsis thaliana pdx1-r5p complex (see paper)
45% identity, 23% coverage: 180:240/269 of query aligns to 188:251/275 of 5lnsA
Sites not aligning to the query:
2issB Structure of the plp synthase holoenzyme from thermotoga maritima (see paper)
34% identity, 42% coverage: 154:266/269 of query aligns to 172:283/285 of 2issB
Sites not aligning to the query:
5lntA Crystal structure of arabidopsis thaliana pdx1k166r-prei320 complex (see paper)
38% identity, 26% coverage: 177:246/269 of query aligns to 186:258/273 of 5lntA
Sites not aligning to the query:
Q03148 Pyridoxal 5'-phosphate synthase subunit SNZ1; PLP synthase subunit SNZ1; PDX1 homolog 1; Pdx1.1; p35; EC 4.3.3.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
41% identity, 20% coverage: 183:236/269 of query aligns to 196:251/297 of Q03148
Sites not aligning to the query:
3o05A Crystal structure of yeast pyridoxal 5-phosphate synthase snz1 complxed with substrate plp (see paper)
41% identity, 20% coverage: 183:236/269 of query aligns to 182:237/261 of 3o05A
Sites not aligning to the query:
O14027 Probable pyridoxal 5'-phosphate synthase subunit PDX1; PLP synthase subunit PDX1; EC 4.3.3.6 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
48% identity, 19% coverage: 191:240/269 of query aligns to 206:257/296 of O14027
Sites not aligning to the query:
>HSERO_RS02130 FitnessBrowser__HerbieS:HSERO_RS02130
MNMNDAPLVNEDKGLTIAGKTYRSRLLVGSGKYKDLDETRAATVASGAEIITVAIRRVNI
GQDPNAPSLLDAVPPSEFTILPNTAGCYNAADAVYTLQLARELLGGHKLVKLEVLGDEKT
LFPNMPETLKAAETLVKDGFDVMVYCSDDPIQARMLEDLGVAAVMPLASLIGSGMGILNP
WNLSLIIEQARVPVLVDAGVGTASDAAIAMELGCDGVLMNTAIACARDPIRMARAMKLAV
QAGREAFLSGRIPRKFAASPSSPMAGRVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory