SitesBLAST
Comparing HSERO_RS02795 FitnessBrowser__HerbieS:HSERO_RS02795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
37% identity, 100% coverage: 1:385/386 of query aligns to 1:344/346 of 4cpdA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), H43 (= H43), H59 (= H60), E60 (= E61), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), G107 (≠ A113), D152 (= D170), T156 (= T174), K340 (= K381)
- binding nicotinamide-adenine-dinucleotide: G39 (= G39), S40 (= S40), T156 (= T174), G178 (= G196), P179 (= P197), V180 (= V198), D200 (= D218), R201 (≠ H219), R205 (= R223), A243 (= A262), V244 (= V263), V266 (≠ P305), V268 (= V307), L292 (≠ Q331), A293 (≠ T332), F333 (= F372)
- binding zinc ion: C38 (= C38), H59 (= H60), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), D152 (= D170)
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
37% identity, 96% coverage: 2:373/386 of query aligns to 3:379/395 of 4jlwA
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), D168 (= D170), T172 (= T174), G194 (= G196), P195 (= P197), V196 (= V198), D216 (= D218), R221 (= R223), V261 (= V263), R266 (≠ K268), H268 (≠ S270), V281 (≠ A288), P298 (= P305), L300 (≠ V307), Q336 (= Q331), T337 (= T332)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D168 (= D170)
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
35% identity, 96% coverage: 2:373/386 of query aligns to 5:381/399 of Q52078
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:399 modified: mature protein, Formaldehyde dismutase
2dphA Crystal structure of formaldehyde dismutase
35% identity, 96% coverage: 2:373/386 of query aligns to 4:380/398 of 2dphA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H60), E67 (= E61), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), L114 (vs. gap), S168 (= S169), D169 (= D170), P172 (= P173)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F86), D169 (= D170), T173 (= T174), A192 (≠ Y193), G193 (= G194), G195 (= G196), P196 (= P197), V197 (= V198), G216 (≠ V217), D217 (= D218), Q218 (≠ H219), R222 (= R223), L236 (vs. gap), V262 (= V263), H267 (≠ K268), P298 (= P305), G299 (= G306), I300 (≠ V307), A337 (≠ T332)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D169 (= D170)
Sites not aligning to the query:
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
37% identity, 96% coverage: 2:373/386 of query aligns to 3:379/396 of 1kolA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H60), E67 (= E61), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), N114 (= N108), D168 (= D170), T172 (= T174)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F86), D168 (= D170), T172 (= T174), G192 (= G194), G194 (= G196), P195 (= P197), V196 (= V198), D216 (= D218), L217 (≠ H219), R221 (= R223), A260 (= A262), V261 (= V263), R266 (≠ K268), H268 (≠ S270), V281 (≠ A288), P298 (= P305), L300 (≠ V307), Q336 (= Q331), T337 (= T332)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D168 (= D170)
Sites not aligning to the query:
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
30% identity, 99% coverage: 1:384/386 of query aligns to 5:341/348 of 5ylnA
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
37% identity, 96% coverage: 2:373/386 of query aligns to 5:381/399 of P46154
P80222 Alcohol dehydrogenase 1; Alcohol dehydrogenase, major; EC 1.1.1.1 from Alligator mississippiensis (American alligator) (see paper)
29% identity, 90% coverage: 24:372/386 of query aligns to 32:362/374 of P80222
Sites not aligning to the query:
- 1 modified: N-acetylserine
3fpcA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-294 of t. Brockii adh by e. Histolytica adh (see paper)
32% identity, 62% coverage: 27:264/386 of query aligns to 26:244/352 of 3fpcA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ A103), T92 (= T106), V95 (≠ P109), S103 (≠ A117), D150 (= D170), T154 (= T174)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D170)
Sites not aligning to the query:
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
29% identity, 90% coverage: 17:363/386 of query aligns to 20:320/343 of 2ejvA
- active site: C38 (= C38), G39 (= G39), T40 (≠ S40), H43 (= H43), H63 (= H60), E64 (= E61), C93 (= C90), C96 (= C93), C99 (= C96), C107 (= C104), Q111 (≠ N108), P149 (≠ D170), A153 (≠ T174)
- binding nicotinamide-adenine-dinucleotide: G172 (= G194), G174 (= G196), P175 (= P197), I176 (≠ V198), S195 (≠ V217), D196 (= D218), P197 (≠ H219), R201 (= R223), F238 (≠ A262), S239 (≠ V263), N241 (≠ F265), A244 (= A288), L261 (≠ P305), G262 (= G306), I263 (≠ V307)
- binding zinc ion: C38 (= C38), H63 (= H60), E64 (= E61), C96 (= C93), C99 (= C96), C107 (= C104)
Sites not aligning to the query:
2dq4A Crystal structure of threonine 3-dehydrogenase
29% identity, 90% coverage: 17:363/386 of query aligns to 20:320/343 of 2dq4A
- active site: C38 (= C38), G39 (= G39), T40 (≠ S40), H43 (= H43), H63 (= H60), E64 (= E61), C93 (= C90), C96 (= C93), C99 (= C96), C107 (= C104), Q111 (≠ N108), P149 (≠ D170), A153 (≠ T174)
- binding zinc ion: C38 (= C38), H63 (= H60), E64 (= E61), C93 (= C90), C96 (= C93), C107 (= C104)
Sites not aligning to the query:
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
29% identity, 90% coverage: 17:363/386 of query aligns to 20:320/343 of Q5SKS4
P35630 NADP-dependent isopropanol dehydrogenase; EhADH1; EC 1.1.1.80 from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see paper)
28% identity, 93% coverage: 27:384/386 of query aligns to 32:355/366 of P35630
- C43 (= C38) binding
- H65 (= H60) binding
- E66 (= E61) binding
- D156 (= D170) binding
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
28% identity, 92% coverage: 27:380/386 of query aligns to 29:334/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H43), H65 (= H60), E66 (= E61), C95 (= C90), C98 (= C93), C101 (= C96), C109 (= C104), K113 (≠ N108), P151 (= P173), A155 (= A178)
- binding nicotinamide-adenine-dinucleotide: G175 (= G196), P176 (= P197), L177 (≠ V198), E197 (≠ D218), P198 (≠ H219), R202 (= R223), F241 (≠ A262), S242 (≠ V263), A244 (≠ S285), L264 (≠ P305), G265 (= G306), L266 (≠ V307), I289 (vs. gap), T290 (= T329)
- binding zinc ion: C95 (= C90), C101 (= C96), C109 (= C104)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
28% identity, 92% coverage: 27:380/386 of query aligns to 31:336/348 of O58389
- C42 (= C38) binding
- T44 (≠ S40) mutation to A: Total loss of enzymatic activity.
- H67 (= H60) binding
- E68 (= E61) binding
- C97 (= C90) binding
- C100 (= C93) binding
- C103 (= C96) binding
- C111 (= C104) binding
- E152 (≠ V165) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ V198) binding
- E199 (≠ D218) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R223) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ PGV 305:307) binding
- IT 291:292 (≠ -T 329) binding
- R294 (≠ Q331) mutation to A: 4000-fold decrease in catalytic efficiency.
1y9aA Alcohol dehydrogenase from entamoeba histolotica in complex with cacodylate (see paper)
28% identity, 93% coverage: 27:384/386 of query aligns to 26:349/360 of 1y9aA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (= D110), E92 (≠ A113), S95 (≠ N116), S103 (= S122), D150 (= D170), T154 (= T174), K346 (= K381)
- binding acetate ion: G69 (= G70), S70 (≠ P71)
- binding cacodylate ion: S39 (= S40), H59 (= H60), W110 (≠ Y129), D150 (= D170)
- binding 1,2-ethanediol: G98 (= G119), Y99 (vs. gap), M101 (≠ I120), H157 (≠ Q177)
- binding zinc ion: C37 (= C38), D51 (≠ T52), H53 (≠ A54), H59 (= H60), D150 (= D170)
Sites not aligning to the query:
2ouiA D275p mutant of alcohol dehydrogenase from protozoa entamoeba histolytica (see paper)
28% identity, 93% coverage: 27:384/386 of query aligns to 26:349/360 of 2ouiA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (= D110), E92 (≠ A113), S95 (≠ N116), S103 (= S122), D150 (= D170), T154 (= T174), K346 (= K381)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D170)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
30% identity, 75% coverage: 1:289/386 of query aligns to 4:261/343 of 4ej6A
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H43), H61 (= H60), E62 (= E61), C91 (= C90), C94 (= C93), C97 (= C96), C105 (= C104), R109 (≠ N116), P147 (≠ I171), C151 (≠ G175)
- binding zinc ion: C91 (= C90), C94 (= C93), C97 (= C96), C105 (= C104)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
30% identity, 75% coverage: 1:289/386 of query aligns to 4:261/342 of 4ejmA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H43), H61 (= H60), E62 (= E61), C91 (= C90), C94 (= C93), C97 (= C96), C105 (= C104), R109 (≠ N116), P147 (≠ I171), C151 (≠ G175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G194), G172 (= G196), V173 (≠ P197), I174 (≠ V198), T194 (≠ D218), R195 (≠ H219), Q196 (≠ H220), K199 (≠ R223), C240 (≠ A262), E245 (= E273), T246 (= T274)
- binding zinc ion: C91 (= C90), C94 (= C93), C97 (= C96), C105 (= C104)
Sites not aligning to the query:
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
28% identity, 93% coverage: 27:384/386 of query aligns to 26:349/352 of 1ykfA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ A103), T92 (= T106), V95 (≠ P109), S103 (≠ A117), D150 (= D170), T154 (= T174), K346 (= K381)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (= S40), D150 (= D170), T154 (= T174), G174 (= G194), I175 (≠ A195), G176 (= G196), P177 (= P197), V178 (= V198), S199 (≠ H219), R200 (≠ H220), Y218 (≠ F238), I223 (≠ A244), N266 (≠ R297), Y267 (vs. gap)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D170)
Query Sequence
>HSERO_RS02795 FitnessBrowser__HerbieS:HSERO_RS02795
MRALLYHSAHDVRVETVPDPIIQEADDVILKVTATAICGSDLHLYRGKIPATKAGDILGH
EFMGVVVEAGPAIKRLKKGDRVVVPFVIACGQCFFCDQHLYAACETTNPDRGALMNAKGI
RSGAAMFGYSHLYGGMPGGQAEYVRVPKADVGPIRIDSALADEQVLFLSDILPTGYQAVK
NAGVREGSSVAIYGAGPVGQMAAASARMLGAERIFMVDHHAYRLRFAQEQYDVIPVNFDQ
VDPAEYIIANTAGRGVDGVIDAVGFEAKGSVLETAMTTLKLEGSSGQALRHCIASVRRGG
VISVPGVYAGFIHGFLFGDIFEKGVTVKTGQTHVQHYMPELLASIEEGRLRPDAIITHRL
PLEDAARGYQIFNDKLEDCRKVVLTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory