SitesBLAST
Comparing HSERO_RS02920 FitnessBrowser__HerbieS:HSERO_RS02920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
31% identity, 95% coverage: 13:420/428 of query aligns to 1:404/409 of 6e9nA
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
31% identity, 95% coverage: 13:420/428 of query aligns to 12:423/430 of P0AA76
- Y29 (= Y30) binding
- D31 (= D32) mutation to N: Loss of galactonate transport activity.
- R32 (= R33) binding
- Y64 (= Y65) binding
- E118 (= E119) mutation to Q: Loss of galactonate transport activity.
- W358 (= W354) binding
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
29% identity, 96% coverage: 13:422/428 of query aligns to 4:390/393 of 6e9oA
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 91% coverage: 27:416/428 of query aligns to 95:494/582 of Q9JI12
- H128 (≠ L58) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R112) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E119) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ V246) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
23% identity, 91% coverage: 27:416/428 of query aligns to 37:436/452 of 7t3nA
Sites not aligning to the query:
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
23% identity, 82% coverage: 1:352/428 of query aligns to 1:392/493 of Q03567
- N69 (= N40) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
22% identity, 92% coverage: 36:428/428 of query aligns to 90:486/495 of Q9NRA2
- K136 (≠ R82) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ A127) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ PT 142:143) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LA 208:209) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ DDHDN 210:214) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G273) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P279) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (= G315) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
22% identity, 93% coverage: 32:428/428 of query aligns to 77:486/495 of Q8BN82
- H183 (≠ A127) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
22% identity, 93% coverage: 32:428/428 of query aligns to 77:486/495 of Q5Q0U0
- K136 (≠ R82) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R112) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L115) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G116) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E119) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A120) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (= F123) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P124) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ A127) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ V130) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ DDHDN 210:214) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P279) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (= G315) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
22% identity, 86% coverage: 50:417/428 of query aligns to 106:478/497 of Q9Y2C5
- A372 (≠ C313) to T: in dbSNP:rs11754288
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
Q8IVW8 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2 from Homo sapiens (Human) (see 2 papers)
27% identity, 32% coverage: 4:139/428 of query aligns to 90:227/549 of Q8IVW8
- R200 (= R112) mutation to S: Loss of function; does not rescue the cardia bifida phenotype in the morpholino knockdown in zebrafish.
Sites not aligning to the query:
- 319 natural variant: Missing (in DFNB115; uncertain significance; dbSNP:rs749994718)
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
24% identity, 69% coverage: 1:295/428 of query aligns to 5:314/452 of Q5EXK5
- D82 (= D77) mutation to A: Loss of activity.
- V311 (≠ Y292) mutation to W: Loss of activity.
- D314 (= D295) mutation to A: Loss of activity.
O59698 Uncharacterized transporter C36.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 40% coverage: 34:205/428 of query aligns to 156:328/580 of O59698
Sites not aligning to the query:
- 99 modified: Phosphoserine
A2SWM2 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2; Protein two of hearts from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
24% identity, 36% coverage: 4:156/428 of query aligns to 42:197/504 of A2SWM2
- R153 (= R112) mutation to S: In ko157; displays cardia bifida (2 hearts).
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
23% identity, 40% coverage: 13:182/428 of query aligns to 111:281/605 of Q9GQQ0
- E217 (= E119) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
25% identity, 62% coverage: 1:264/428 of query aligns to 12:293/448 of Q51955
- D41 (≠ N29) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D32) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G73) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D77) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G80) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R112) mutation to A: Abolishes 4-HBA transport.
- E144 (= E132) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R171) mutation to A: Decrease in 4-HBA transport and chemotaxis.
Sites not aligning to the query:
- 323 D→N: Abolishes 4-HBA transport and chemotaxis.
- 328 H→A: Decrease in 4-HBA transport and chemotaxis.; H→R: Decrease in 4-HBA transport and loss of chemotaxis.
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
7yubR S1p-bound human spns2 (see paper)
27% identity, 31% coverage: 7:139/428 of query aligns to 1:135/429 of 7yubR
Sites not aligning to the query:
8g92A Structure of inhibitor 16d-bound spns2 (see paper)
27% identity, 29% coverage: 18:139/428 of query aligns to 6:129/415 of 8g92A
Sites not aligning to the query:
7yudR Fty720p-bound human spns2 (see paper)
27% identity, 29% coverage: 18:139/428 of query aligns to 5:128/417 of 7yudR
Sites not aligning to the query:
8jhqA Cryo-em structure of human s1p transporter spns2 bound with s1p (see paper)
27% identity, 29% coverage: 11:134/428 of query aligns to 3:128/446 of 8jhqA
Sites not aligning to the query:
Query Sequence
>HSERO_RS02920 FitnessBrowser__HerbieS:HSERO_RS02920
MEVQKEKSPRLKRIQVVALSFLMLAGIVNYLDRSTLSIANHSVSQELNLSASQMGLLLSA
FSLAYAFSQLPIGAMLDKFGARVMLGAGMFIWSVAQLAGGFVNNLQQFLVARVFLGLGEA
PQFPAGAKVVSEWFAMRERGGPTGIFVASSTIGPALAPPILTILMLSFGWRMMFVIMGVL
GIAVSVGWYLFYRNRNEVQLTPSEVLYLADDHDNDPNANAKLSWSEWKSLFTYRTTWGML
FGFMGVIYMVWLYLTWLPAYLEHERHLSIARTGWVVVIPYIFGTLGMLSSGYIADGLMKR
GMPAIRSRKWPICAGLIGAGAFTIPAAYTPSTTMAIVYISLAMAFVNMASGGAWALVSVA
IPRRLVASLGSMQNFGGYLGGSLAPVITGVVVDQTHSFVNALLISAAVAFAAALVYMFVV
DKPIESHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory