Comparing HSERO_RS02965 FitnessBrowser__HerbieS:HSERO_RS02965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
38% identity, 96% coverage: 11:417/422 of query aligns to 5:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
38% identity, 96% coverage: 11:417/422 of query aligns to 5:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
33% identity, 95% coverage: 13:415/422 of query aligns to 13:408/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
25% identity, 70% coverage: 110:403/422 of query aligns to 101:425/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
25% identity, 70% coverage: 110:403/422 of query aligns to 102:426/456 of 5j7iB
3rhhD Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from bacillus halodurans c-125 complexed with NADP
24% identity, 68% coverage: 115:400/422 of query aligns to 142:457/480 of 3rhhD
6gvsA Engineered glycolyl-coa reductase comprising 8 mutations with bound NADP+ (see paper)
24% identity, 70% coverage: 117:411/422 of query aligns to 104:424/441 of 6gvsA
>HSERO_RS02965 FitnessBrowser__HerbieS:HSERO_RS02965
MENIDLYMNRIGQQARAASRAMARADTAAKNQALLLIAAAIRRDADALRAANALDLEAAR
ANGLAEAMLDRLTLSDKAIATMAEGLEQIASLPDPIGEISNMKYRPTGIQVGQMRVPLGV
IGIIYEARPNVTVDAAGLCIKSGNATILRGGSEAIHCNQALAKLVKEGLAGAGLPEQAVQ
VVETTDRAAVGALITMQEYVDVIVPRGGKGLIERLMKEAKVPMIKHLDGICHVYIDDKAD
TRKALDVAFNAKCHRYGTCNTMETLLVARNIAAAILPPLSELYRVKEVELRCDAEAAEIL
AGYPLLKAATEEDWDTEYLAPILAVKVVADMDEAIEHINRHSSQHTESIITEDYTRAMRF
LREVDSASVMVNASTRFADGFEYGLGAEIGISNDKLHARGPVGLEGLTSLKYIVLGNGQV
RQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory