SitesBLAST
Comparing HSERO_RS03030 FitnessBrowser__HerbieS:HSERO_RS03030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04036 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Escherichia coli (strain K12) (see 3 papers)
59% identity, 98% coverage: 4:265/268 of query aligns to 6:268/273 of P04036
- G12 (= G10) binding
- GRM 15:17 (= GRM 13:15) binding
- RM 16:17 (= RM 14:15) binding
- E38 (≠ D36) binding
- R39 (≠ T37) binding
- TR 80:81 (= TR 77:78) binding
- GTT 102:104 (= GTT 99:101) binding ; binding
- AANF 126:129 (≠ APNM 123:126) binding
- F129 (≠ M126) binding
- H159 (= H156) mutation H->A,Q: 135 to 200-fold reduction in catalytic activity.
- K163 (= K160) binding ; mutation K->A,C,Q: 625 to 830-fold reduction in catalytic activity.
- R240 (= R237) binding
- F243 (≠ Y240) binding
1drvA Escherichia coli dhpr/acnadh complex (see paper)
59% identity, 98% coverage: 4:265/268 of query aligns to 3:265/270 of 1drvA
- active site: H156 (= H156), K160 (= K160)
- binding 3-acetylpyridine adenine dinucleotide: G9 (= G10), G12 (= G13), R13 (= R14), M14 (= M15), E35 (≠ D36), F76 (= F76), T77 (= T77), R78 (= R78), G81 (= G81), G99 (= G99), A124 (≠ P124), F126 (≠ M126), R237 (= R237)
1druA Escherichia coli dhpr/nadh complex (see paper)
59% identity, 98% coverage: 4:265/268 of query aligns to 3:265/270 of 1druA
- active site: H156 (= H156), K160 (= K160)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G12 (= G13), R13 (= R14), M14 (= M15), E35 (≠ D36), R36 (≠ T37), F76 (= F76), T77 (= T77), R78 (= R78), G81 (= G81), G99 (= G99), T100 (= T100), T101 (= T101), A124 (≠ P124), N125 (= N125), F126 (≠ M126), F240 (≠ Y240)
1arzA Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
59% identity, 98% coverage: 4:265/268 of query aligns to 3:265/270 of 1arzA
1arzB Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
59% identity, 98% coverage: 4:265/268 of query aligns to 2:264/269 of 1arzB
- active site: H155 (= H156), K159 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G10), G10 (≠ S12), G11 (= G13), R12 (= R14), M13 (= M15), E34 (≠ D36), F75 (= F76), T76 (= T77), R77 (= R78), G80 (= G81), H84 (= H85), G98 (= G99), T100 (= T101), A123 (≠ P124), N124 (= N125), F125 (≠ M126), F239 (≠ Y240)
- binding pyridine-2,6-dicarboxylic acid: T100 (= T101), H156 (= H157), K159 (= K160), S164 (= S165), G165 (= G166), T166 (= T167), F239 (≠ Y240)
1drwA Escherichia coli dhpr/nhdh complex (see paper)
59% identity, 98% coverage: 4:265/268 of query aligns to 5:267/272 of 1drwA
- active site: H158 (= H156), K162 (= K160)
- binding nicotinamide purin-6-ol-dinucleotide: G11 (= G10), G14 (= G13), R15 (= R14), M16 (= M15), E37 (≠ D36), R38 (≠ T37), F78 (= F76), T79 (= T77), R80 (= R78), G101 (= G99), T102 (= T100), T103 (= T101), A126 (≠ P124), N127 (= N125), F128 (≠ M126), F242 (≠ Y240)
1dihA Three-dimensional structure of e. Coli dihydrodipicolinate reductase (see paper)
59% identity, 98% coverage: 4:265/268 of query aligns to 5:267/272 of 1dihA
- active site: H158 (= H156), K162 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G10), G14 (= G13), R15 (= R14), M16 (= M15), R38 (≠ T37), F78 (= F76), T79 (= T77), R80 (= R78), G83 (= G81), G101 (= G99), T103 (= T101), N127 (= N125), F128 (≠ M126), R239 (= R237), F242 (≠ Y240)
4ywjA Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
55% identity, 99% coverage: 5:268/268 of query aligns to 3:268/268 of 4ywjA
- active site: H156 (= H156), K160 (= K160)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), R12 (= R14), M13 (= M15), D35 (= D36), R36 (≠ T37), F76 (= F76), T77 (= T77), V81 (≠ G81), G99 (= G99), T101 (= T101), A124 (≠ P124), N125 (= N125), F126 (≠ M126), R237 (= R237), F240 (≠ Y240)
5tejB Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
51% identity, 99% coverage: 3:268/268 of query aligns to 1:267/269 of 5tejB
- active site: H155 (= H156), K159 (= K160)
- binding 2,5 Furan Dicarboxylic Acid: T100 (= T101), H156 (= H157), K159 (= K160), S164 (= S165), G165 (= G166), T166 (= T167)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), R12 (= R14), M13 (= M15), E34 (≠ D36), R35 (≠ T37), F75 (= F76), T76 (= T77), S80 (≠ G81), G98 (= G99), T100 (= T101), P123 (= P124), N124 (= N125), Y125 (≠ M126), F239 (≠ Y240)
5tejA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
51% identity, 99% coverage: 3:268/268 of query aligns to 1:267/269 of 5tejA
- active site: H155 (= H156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), R12 (= R14), M13 (= M15), E34 (≠ D36), R35 (≠ T37), F75 (= F76), T76 (= T77), S80 (≠ G81), G98 (= G99), T100 (= T101), P123 (= P124)
5temA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,6 pyridine dicarboxylic and nadh (see paper)
52% identity, 99% coverage: 3:267/268 of query aligns to 1:266/266 of 5temA
- active site: H155 (= H156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), R12 (= R14), M13 (= M15), E34 (≠ D36), R35 (≠ T37), F75 (= F76), T76 (= T77), S80 (≠ G81), G98 (= G99), T100 (= T101), P123 (= P124), N124 (= N125), Y125 (≠ M126), F239 (≠ Y240)
- binding pyridine-2,6-dicarboxylic acid: T100 (= T101), P123 (= P124), H156 (= H157), K159 (= K160), S164 (= S165), G165 (= G166), T166 (= T167)
3ijpB Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
41% identity, 99% coverage: 4:268/268 of query aligns to 2:267/267 of 3ijpB
3ijpA Crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution (see paper)
42% identity, 99% coverage: 4:267/268 of query aligns to 2:266/266 of 3ijpA
- active site: H155 (= H156), K159 (= K160)
- binding sodium ion: I21 (= I23), Q22 (≠ L24), R24 (≠ A26), V27 (≠ L29)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), N10 (≠ S12), G11 (= G13), R12 (= R14), M13 (= M15), R35 (≠ T37), F75 (= F76), S76 (≠ T77), Q77 (≠ R78), A80 (≠ G81), G98 (= G99), T100 (= T101), G123 (≠ P124), N124 (= N125), M125 (= M126), F239 (≠ Y240)
Q9X1K8 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
35% identity, 74% coverage: 67:265/268 of query aligns to 39:212/216 of Q9X1K8
Sites not aligning to the query:
1vm6B Crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution
35% identity, 74% coverage: 67:265/268 of query aligns to 44:217/218 of 1vm6B
- active site: H132 (= H156), K136 (= K160)
- binding nicotinamide-adenine-dinucleotide: F53 (= F76), S54 (≠ T77), S55 (≠ R78), E57 (= E80), A58 (≠ G81), G76 (= G99), T78 (= T101), Y101 (≠ P124), N102 (= N125), F103 (≠ M126), F192 (≠ Y240)
Sites not aligning to the query:
5z2fA NADPH/pda bound dihydrodipicolinate reductase from paenisporosarcina sp. Tg-14 (see paper)
29% identity, 98% coverage: 3:265/268 of query aligns to 2:265/265 of 5z2fA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R11 (≠ S12), G12 (= G13), K13 (≠ R14), M14 (= M15), D35 (= D36), H36 (vs. gap), K37 (vs. gap), L76 (≠ F76), T77 (= T77), G99 (= G99), T100 (= T100), T101 (= T101), P126 (= P124), N127 (= N125), F128 (≠ M126)
- binding pyridine-2,6-dicarboxylic acid: P126 (= P124), H155 (= H156), H156 (= H157), K159 (= K160), S164 (= S165), G165 (= G166), T166 (= T167), A215 (≠ G215)
5z2eA Dipicolinate bound dihydrodipicolinate reductase from paenisporosarcina sp. Tg-14 (see paper)
29% identity, 98% coverage: 3:265/268 of query aligns to 2:265/265 of 5z2eA
1p9lA Structure of m. Tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc (see paper)
29% identity, 97% coverage: 4:264/268 of query aligns to 1:244/245 of 1p9lA
- active site: H132 (= H156), K136 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G7 (= G10), G10 (= G13), K11 (≠ R14), V12 (≠ M15), D33 (= D36), A34 (≠ T37), F52 (= F76), T53 (= T77), V57 (≠ G81), G75 (= G99), T77 (= T101), P103 (= P124), N104 (= N125), F105 (≠ M126), F217 (≠ Y240)
- binding pyridine-2,6-dicarboxylic acid: H133 (= H157), K136 (= K160), S141 (= S165), G142 (= G166), T143 (= T167), A192 (≠ G215)
1c3vA Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with NADPH and pdc (see paper)
29% identity, 97% coverage: 4:264/268 of query aligns to 1:244/245 of 1c3vA
- active site: H132 (= H156), K136 (= K160)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K9 (≠ S12), G10 (= G13), K11 (≠ R14), V12 (≠ M15), D33 (= D36), A34 (≠ T37), F52 (= F76), T53 (= T77), V57 (≠ G81), G75 (= G99), T77 (= T101), P103 (= P124), N104 (= N125), F217 (≠ Y240)
- binding pyridine-2,6-dicarboxylic acid: T77 (= T101), N104 (= N125), K136 (= K160), S141 (= S165), G142 (= G166), T143 (= T167), A192 (≠ G215)
5ugvA Dapb from mycobacterium tuberculosis (see paper)
29% identity, 97% coverage: 4:264/268 of query aligns to 2:245/245 of 5ugvA
Query Sequence
>HSERO_RS03030 FitnessBrowser__HerbieS:HSERO_RS03030
MTVLNIAVAGASGRMGRMLIEAILNADDLQLAGALDTPTSPSIGTDAGLFLGKATGVLIE
SDLARGLAKADVLIDFTRPEGTLKHLEYCAAHGVKVVIGTTGFEPEGKAAIAAYAEKTAI
MAAPNMSVGVNVTMKLLEMAAKNFSHGYDIEIIEAHHRFKVDAPSGTALKMGEVIADALG
KKLDDVAVYAREGVTGERDPSSIGFATVRGGDIIGDHTVLFAGIGERIEISHKSSSRVSY
AMGSLRAARYLADKETGLYDMQDVLGFK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory