Comparing HSERO_RS03050 FitnessBrowser__HerbieS:HSERO_RS03050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3vayA Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. Tomato dc3000 (see paper)
39% identity, 89% coverage: 17:234/244 of query aligns to 2:222/230 of 3vayA
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
31% identity, 82% coverage: 17:215/244 of query aligns to 1:189/215 of 4ygrA
4knvA The crystal structure of apo human hdhd4 from se-mad (see paper)
27% identity, 82% coverage: 17:217/244 of query aligns to 1:210/241 of 4knvA
6z1kA A de novo enzyme for the morita-baylis-hillman reaction bh32.6 (see paper)
30% identity, 48% coverage: 118:234/244 of query aligns to 101:222/231 of 6z1kA
Sites not aligning to the query:
6q7nA Crystal structure of bh32 alkylated with the mechanistic inhibitor 2- bromoacetophenone (see paper)
29% identity, 48% coverage: 118:234/244 of query aligns to 101:222/230 of 6q7nA
Sites not aligning to the query:
4ffdA Crystal structure of engineered protein. Northeast structural genomics consortium target or48
29% identity, 48% coverage: 118:234/244 of query aligns to 101:222/230 of 4ffdA
Sites not aligning to the query:
Q9HZ62 N-acetylmuramic acid 6-phosphate phosphatase; MurNAc 6-phosphate phosphatase; MurNAc-6P phosphatase; EC 3.1.3.105 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
26% identity, 84% coverage: 17:221/244 of query aligns to 6:198/226 of Q9HZ62
2yn4A L-2-chlorobutryic acid bound complex l-haloacid dehalogenase from a rhodobacteraceae family bacterium (see paper)
29% identity, 54% coverage: 114:244/244 of query aligns to 87:225/225 of 2yn4A
Sites not aligning to the query:
2x4dA Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
30% identity, 48% coverage: 123:238/244 of query aligns to 148:265/270 of 2x4dA
Sites not aligning to the query:
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
32% identity, 50% coverage: 121:242/244 of query aligns to 91:221/221 of 2wf9A
Sites not aligning to the query:
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
32% identity, 50% coverage: 121:242/244 of query aligns to 91:221/221 of 1o03A
Sites not aligning to the query:
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
32% identity, 50% coverage: 121:242/244 of query aligns to 91:221/221 of 1lvhA
Sites not aligning to the query:
3i76B The crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
25% identity, 92% coverage: 18:241/244 of query aligns to 4:229/229 of 3i76B
5ok0A Structure of the d10n mutant of beta-phosphoglucomutase from lactococcus lactis trapped with native reaction intermediate beta- glucose 1,6-bisphosphate to 2.2a resolution.
33% identity, 44% coverage: 121:228/244 of query aligns to 91:200/218 of 5ok0A
Sites not aligning to the query:
5o6rA Structure of beta-phosphoglucomutase d10n mutant in complex with glucose-1-phosphate and aluminium tetrafluoride
33% identity, 44% coverage: 121:228/244 of query aligns to 91:200/218 of 5o6rA
Sites not aligning to the query:
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
33% identity, 44% coverage: 121:228/244 of query aligns to 91:200/218 of 6h91A
Sites not aligning to the query:
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
33% identity, 44% coverage: 121:228/244 of query aligns to 91:200/218 of 4c4rA
Sites not aligning to the query:
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
33% identity, 44% coverage: 121:228/244 of query aligns to 91:200/218 of 3zi4A
Sites not aligning to the query:
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
33% identity, 44% coverage: 121:228/244 of query aligns to 91:200/218 of 2wf8A
Sites not aligning to the query:
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
33% identity, 44% coverage: 121:228/244 of query aligns to 91:200/218 of 2wf7A
Sites not aligning to the query:
>HSERO_RS03050 FitnessBrowser__HerbieS:HSERO_RS03050
MKPSASTLPASPAASPIQAVLFDLDDTLWAIEPVLVRAETLLYDWLRQHAPAVAAAHTIA
SLRERRMALMQTDPAYRINLWKLRHTALSEVFREHDVDLALVDPAMALFSEARSTVALFD
DVEPALLRLKGKLTLGSVSNGFADLERIGLAGHFGVSIAAHRFGRAKPDPAIFHAACEAL
QVAPGATVYVGDDPLLDVQGAQQAGLKAVWMNRFGRVLPEDIRPDAVCRDLHELHDWLEA
QSAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory