SitesBLAST
Comparing HSERO_RS03055 FitnessBrowser__HerbieS:HSERO_RS03055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B3 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Escherichia coli (strain K12) (see paper)
44% identity, 85% coverage: 37:296/305 of query aligns to 29:289/292 of P0A7B3
- R175 (= R183) mutation to E: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to G: Exhibits NADH kinase activity in addition to NAD kinase activity. Reduces the Vmax of the NAD kinase activity.; mutation to H: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to I: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to K: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to Q: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to T: Exhibits NADH kinase activity in addition to NAD kinase activity.
7mh7A Crystal structure of NAD kinase from pseudomonas aeruginosa pao1
40% identity, 92% coverage: 14:294/305 of query aligns to 4:286/290 of 7mh7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D71 (= D81), G72 (= G82), R93 (≠ Q103), F98 (= F108), N145 (= N155), D146 (= D156), T186 (= T196), A187 (= A197), Y188 (= Y198), S191 (= S201), D244 (= D252), K283 (= K291)
P9WHV7 NAD kinase; ATP-dependent NAD kinase; Poly(P)-dependent NAD kinase; PPNK; EC 2.7.1.23 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
33% identity, 73% coverage: 70:293/305 of query aligns to 70:298/307 of P9WHV7
- D85 (= D81) mutation to A: Abolishes catalytic activity.
- N159 (= N155) mutation to A: Abolishes catalytic activity.
- NE 159:160 (≠ ND 155:156) binding
- E160 (≠ D156) mutation to A: Abolishes catalytic activity.
- G190 (= G186) mutation to A: Abolishes catalytic activity.
- L192 (≠ I188) mutation to A: Abolishes catalytic activity.
- T195 (= T191) mutation to A: It promotes stronger allosteric interactions.
- P196 (= P192) mutation to A: Abolishes catalytic activity.
- T197 (= T193) binding ; mutation to A: Abolishes catalytic activity.
- G198 (= G194) mutation to A: Abolishes catalytic activity.
- S199 (= S195) mutation to A: Lower catalytic efficiency. A perturbation of the allosteric interactions is observed when NAD is used as substrate.
- T200 (= T196) mutation to A: Abolishes catalytic activity.
- TAYAFS 200:205 (≠ TAYALS 196:201) binding
- Y202 (= Y198) mutation to A: Abolishes catalytic activity.
- G207 (= G203) mutation to A: Abolishes catalytic activity.
- G208 (= G204) mutation to A: Possesses 30% of the activity compared to the wild-type enzyme. While mutant affects the catalytic efficiency, it does not alter the binding affinity for ATP and poly(P). It causes a decrease in the affinity for NAD and alters the allosteric interactions mediated by the dinucleotide, both in the presence of poly(P) and ATP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1y3iA Crystal structure of mycobacterium tuberculosis NAD kinase-NAD complex (see paper)
34% identity, 70% coverage: 79:293/305 of query aligns to 12:227/231 of 1y3iA
- binding nicotinamide-adenine-dinucleotide: D14 (= D81), G15 (= G82), R38 (= R105), F41 (= F108), L42 (≠ I109), N88 (= N155), E89 (≠ D156), T129 (= T196), A130 (= A197), Y131 (= Y198), S134 (= S201)
3afoA Crystal structure of yeast nadh kinase complexed with nadh
33% identity, 58% coverage: 66:241/305 of query aligns to 105:282/360 of 3afoA
- binding 1,4-dihydronicotinamide adenine dinucleotide: D120 (= D81), G121 (= G82), L124 (= L85), F148 (= F108), N196 (= N155), D197 (= D156), T237 (= T196), A238 (= A197), Y239 (= Y198), S242 (= S201)
Sites not aligning to the query:
Q9P7K3 Uncharacterized kinase C24B10.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 73% coverage: 73:295/305 of query aligns to 176:407/449 of Q9P7K3
Sites not aligning to the query:
- 420 modified: Phosphoserine
O13863 Uncharacterized kinase C1B1.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 73% coverage: 73:296/305 of query aligns to 280:513/537 of O13863
Sites not aligning to the query:
- 72 modified: Phosphoserine
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
31% identity, 71% coverage: 35:252/305 of query aligns to 4:217/249 of 1z0zA
- active site: E96 (= E130), C105 (≠ A139)
- binding nicotinamide-adenine-dinucleotide: N115 (= N155), E116 (≠ D156), M127 (= M167), R143 (= R183), D145 (= D185), T156 (= T196), Y158 (= Y198), S161 (= S201), F182 (≠ H222), D209 (≠ G244), G210 (≠ R245)
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
31% identity, 71% coverage: 35:252/305 of query aligns to 4:217/249 of 1z0sA
- active site: E96 (= E130), C105 (≠ A139)
- binding adenosine-5'-triphosphate: R54 (≠ G86), N115 (= N155), E116 (≠ D156), A125 (≠ S165), K126 (≠ G166), M127 (= M167), D145 (= D185), G157 (≠ A197), Y158 (= Y198), S161 (= S201), A180 (≠ S220), F182 (≠ H222), D209 (≠ G244)
- binding pyrophosphate 2-: K8 (≠ E39), G48 (= G80), G50 (= G82), T51 (= T83), R54 (≠ G86), R72 (= R105)
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
31% identity, 71% coverage: 35:252/305 of query aligns to 4:217/249 of 1suwA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G48 (= G80), D49 (= D81), G50 (= G82), N115 (= N155), E116 (≠ D156), A125 (≠ S165), M127 (= M167), R143 (= R183), D145 (= D185), T156 (= T196), Y158 (= Y198), S161 (= S201), F182 (≠ H222), D209 (≠ G244), G210 (≠ R245)
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
31% identity, 71% coverage: 35:252/305 of query aligns to 4:217/249 of O30297
6rbzA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
29% identity, 72% coverage: 57:276/305 of query aligns to 21:243/262 of 6rbzA
7zzhA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
30% identity, 72% coverage: 57:276/305 of query aligns to 21:245/264 of 7zzhA
- binding (1~{R},22~{R},23~{S},24~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-23,24-bis(oxidanyl)-25-oxa-2,4,6,9,14,17,20-heptazatetracyclo[20.2.1.0^{2,10}.0^{3,8}]pentacosa-3(8),4,6,9-tetraen-11-yne-16,19-dione: D45 (= D81), F74 (= F108), Y75 (≠ I109), N122 (= N155), E123 (≠ D156), T161 (= T196), A162 (= A197), Y163 (= Y198), S166 (= S201)
7zzfA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
30% identity, 72% coverage: 57:276/305 of query aligns to 21:245/264 of 7zzfA
- binding (1~{R},23~{R},24~{S},25~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-24,25-bis(oxidanyl)-26-oxa-2,4,6,9,14,17,21-heptazatetracyclo[21.2.1.0^{2,10}.0^{3,8}]hexacosa-3(8),4,6,9-tetraen-11-yne-18,20-dione: D45 (= D81), F74 (= F108), Y75 (≠ I109), N122 (= N155), E123 (≠ D156), T161 (= T196), A162 (= A197), Y163 (= Y198), S166 (= S201)
7zzbA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
30% identity, 72% coverage: 57:276/305 of query aligns to 21:245/264 of 7zzbA
- binding 2-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-[(2-azanylethylcarbamoylamino)methyl]-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl]amino]ethanoic acid: D45 (= D81), G46 (= G82), F74 (= F108), Y75 (≠ I109), N122 (= N155), E123 (≠ D156), T161 (= T196), A162 (= A197), Y163 (= Y198), S166 (= S201), H223 (≠ M253)
7zz7A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
30% identity, 72% coverage: 57:276/305 of query aligns to 21:245/264 of 7zz7A
- binding 2-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-[3-[6-azanyl-9-[(2~{R},3~{R},4~{S},5~{R})-5-[(2-azanylethanoylamino)methyl]-3,4-bis(oxidanyl)oxolan-2-yl]purin-8-yl]prop-2-ynyl]amino]ethanoic acid: D45 (= D81), G46 (= G82), F74 (= F108), Y75 (≠ I109), N122 (= N155), E123 (≠ D156), T161 (= T196), A162 (= A197), Y163 (= Y198), S166 (= S201), H223 (≠ M253)
6rbvA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
30% identity, 72% coverage: 57:276/305 of query aligns to 21:245/264 of 6rbvA
2i2cA Crystal structure of lmnadk1 (see paper)
30% identity, 72% coverage: 57:276/305 of query aligns to 21:245/264 of 2i2cA
- binding (2s,3s,4r,5r,2's,3's,4'r,5'r)-2,2'-[dithiobis(methylene)]bis[5-(6-amino-9h-purin-9-yl)tetrahydrofuran-3,4-diol]: D45 (= D81), F74 (= F108), Y75 (≠ I109), N122 (= N155), E123 (≠ D156), T161 (= T196), A162 (= A197), Y163 (= Y198), S166 (= S201)
2i2aA Crystal structure of lmnadk1 from listeria monocytogenes (see paper)
30% identity, 72% coverage: 57:276/305 of query aligns to 21:245/264 of 2i2aA
- binding glycerol: H173 (= H208)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G44 (= G80), D45 (= D81), G46 (= G82), F74 (= F108), Y75 (≠ I109), N122 (= N155), E123 (≠ D156), T161 (= T196), A162 (= A197), Y163 (= Y198), S166 (= S201), H223 (≠ M253)
Sites not aligning to the query:
Q8Y8D7 NAD kinase 1; ATP-dependent NAD kinase; EC 2.7.1.23 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) (see 2 papers)
30% identity, 72% coverage: 57:276/305 of query aligns to 21:245/264 of Q8Y8D7
- D45 (= D81) active site, Proton acceptor; mutation to N: Only minor changes in the structure and a 10-fold decrease in the kinase activity.
- DG 45:46 (= DG 81:82) binding
- G46 (= G82) binding
- NE 122:123 (≠ ND 155:156) binding
- S158 (≠ T193) binding
- TAYNKS 161:166 (≠ TAYALS 196:201) binding
- H223 (≠ M253) binding ; mutation to E: Twice less active than the wild-type. Its activity toward DTA is increased 2-fold.
Query Sequence
>HSERO_RS03055 FitnessBrowser__HerbieS:HSERO_RS03055
MWPIKLPVQAAVPKTVAIVGKFQAVGIAQILSDIAVFLESHGHTVVFEAETAENVALQGY
DSLTTEQIGQHADVAIVVGGDGTMLGIARQLAPYNVPLIGINQGRLGFITDIAQDRMIPA
LADMLEGKVEAESRSLLEARVYREGGEIFRALALNDVVVARGSTSGMVELRVEVDGRFMY
NQRSDGLIVATPTGSTAYALSAGGPILHPSLHGIVMVPISPHSLSNRPITLSDSCEIVIQ
VVSGREVSANFDMQSLTSVLHGDRIVIRRSAHKITFLHPQGWSYFDTLREKLHWNEYPSI
EGRLQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory