Comparing HSERO_RS03345 FitnessBrowser__HerbieS:HSERO_RS03345 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A799 Phosphoglycerate kinase; EC 2.7.2.3 from Escherichia coli (strain K12) (see 3 papers)
61% identity, 100% coverage: 1:396/396 of query aligns to 1:386/387 of P0A799
1zmrA Crystal structure of the e. Coli phosphoglycerate kinase (see paper)
62% identity, 98% coverage: 10:396/396 of query aligns to 5:385/386 of 1zmrA
4feyA An x-ray structure of a putative phosphogylcerate kinase with bound adp from francisella tularensis subsp. Tularensis schu s4
56% identity, 100% coverage: 1:395/396 of query aligns to 1:390/392 of 4feyA
4ng4B Structure of phosphoglycerate kinase (cbu_1782) from coxiella burnetii (see paper)
56% identity, 98% coverage: 10:396/396 of query aligns to 5:389/389 of 4ng4B
P40924 Phosphoglycerate kinase; EC 2.7.2.3 from Bacillus subtilis (strain 168) (see paper)
48% identity, 95% coverage: 15:391/396 of query aligns to 11:391/394 of P40924
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
46% identity, 96% coverage: 10:388/396 of query aligns to 6:391/654 of P36204
1vpeA Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima (see paper)
46% identity, 96% coverage: 10:388/396 of query aligns to 5:390/398 of 1vpeA
1phpA Structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms (see paper)
47% identity, 96% coverage: 10:388/396 of query aligns to 6:388/394 of 1phpA
P18912 Phosphoglycerate kinase; EC 2.7.2.3 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
47% identity, 96% coverage: 10:388/396 of query aligns to 6:388/394 of P18912
16pkA Phosphoglycerate kinase from trypanosoma brucei bisubstrate analog (see paper)
39% identity, 96% coverage: 10:391/396 of query aligns to 5:412/415 of 16pkA
13pkA Ternary complex of phosphoglycerate kinase from trypanosoma brucei (see paper)
39% identity, 96% coverage: 10:391/396 of query aligns to 5:412/415 of 13pkA
P07378 Phosphoglycerate kinase, glycosomal; Phosphoglycerate kinase C; EC 2.7.2.3 from Trypanosoma brucei brucei (see 2 papers)
38% identity, 97% coverage: 10:395/396 of query aligns to 9:420/440 of P07378
2wzcA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and aluminium tetrafluoride (see paper)
42% identity, 95% coverage: 15:391/396 of query aligns to 12:402/405 of 2wzcA
2wzbA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp, 3pg and magnesium trifluoride (see paper)
42% identity, 95% coverage: 15:391/396 of query aligns to 12:402/405 of 2wzbA
2wzdA The catalytically active fully closed conformation of human phosphoglycerate kinase k219a mutant in complex with adp, 3pg and aluminium trifluoride (see paper)
41% identity, 95% coverage: 15:391/396 of query aligns to 12:402/405 of 2wzdA
4axxA The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp 3-phosphoglycerate and beryllium trifluoride
41% identity, 95% coverage: 15:391/396 of query aligns to 12:404/407 of 4axxA
2x15A The catalytically active fully closed conformation of human phosphoglycerate kinase in complex with adp and 1,3- bisphosphoglycerate
41% identity, 95% coverage: 15:391/396 of query aligns to 12:405/408 of 2x15A
P09041 Phosphoglycerate kinase 2; Phosphoglycerate kinase, testis specific; EC 2.7.2.3 from Mus musculus (Mouse) (see paper)
40% identity, 95% coverage: 15:391/396 of query aligns to 14:414/417 of P09041
P00560 Phosphoglycerate kinase; EC 2.7.2.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
39% identity, 97% coverage: 10:394/396 of query aligns to 9:415/416 of P00560
2paaA Crystal structure of phosphoglycerate kinase-2 bound to atp and 3pg (see paper)
40% identity, 95% coverage: 15:391/396 of query aligns to 10:410/413 of 2paaA
>HSERO_RS03345 FitnessBrowser__HerbieS:HSERO_RS03345
MKFNRLSDLISNKQLQGKRVFIRADLNVPQDDAGNITEDTRIRASVPAIREAQQAGAAVM
VTSHLGRPTEGEFKPEDSLAPVAKRLSELLGSEVKLVANWVDGVDVQPGQVVLLENCRLN
KGEKKNSDELAQKIAKLCDIYVNDAFGTAHRAEATTYGVAKFAPVACAGPLLAAELDALG
KALNQPARPLVAIVAGSKVSTKLTILKTLAEKVDNLIVGGGIANTFMLAAGLKIGKSLAE
PDLVDDAKAIIDLMAKRGASVPIPTDVVVGKEFSPTAAATVKAAADVADDDMIFDIGPQT
AAALAEQLGRAGTIVWNGPVGVFEFDQFGGGTETLARAIAASSGFSIAGGGDTLAAIAKY
NIADKVGYISTGGGAFLEFLEGKTLPAVEILLQRAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory