Comparing HSERO_RS03635 FitnessBrowser__HerbieS:HSERO_RS03635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
39% identity, 88% coverage: 30:306/316 of query aligns to 1:273/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
32% identity, 91% coverage: 27:312/316 of query aligns to 7:284/284 of 7e7mC
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
35% identity, 74% coverage: 26:258/316 of query aligns to 1:239/287 of 5dteB
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 95% coverage: 6:306/316 of query aligns to 8:307/349 of A0QYB5
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
32% identity, 85% coverage: 31:300/316 of query aligns to 3:265/271 of 1dbpA
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 90% coverage: 24:306/316 of query aligns to 29:307/349 of A0QYB3
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
32% identity, 87% coverage: 32:306/316 of query aligns to 5:275/315 of 4rsmA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
30% identity, 89% coverage: 32:312/316 of query aligns to 4:289/292 of 2fn8A
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
32% identity, 88% coverage: 30:306/316 of query aligns to 2:274/315 of 4rs3A
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
32% identity, 88% coverage: 30:306/316 of query aligns to 2:274/314 of 5hkoA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
28% identity, 90% coverage: 26:310/316 of query aligns to 3:284/287 of 4yo7A
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
30% identity, 86% coverage: 30:300/316 of query aligns to 3:265/270 of 4zjpA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
29% identity, 84% coverage: 31:297/316 of query aligns to 3:265/313 of 2h3hA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
29% identity, 85% coverage: 29:297/316 of query aligns to 1:265/305 of 3c6qC
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
30% identity, 65% coverage: 43:248/316 of query aligns to 2:220/301 of 2x7xA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
28% identity, 86% coverage: 39:309/316 of query aligns to 15:287/289 of 5hqjA
Sites not aligning to the query:
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
31% identity, 81% coverage: 53:308/316 of query aligns to 24:287/295 of 4rxtA
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
27% identity, 78% coverage: 34:279/316 of query aligns to 6:259/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
27% identity, 78% coverage: 34:279/316 of query aligns to 6:259/288 of 1gudA
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
26% identity, 88% coverage: 32:309/316 of query aligns to 5:290/297 of 4ry9B
>HSERO_RS03635 FitnessBrowser__HerbieS:HSERO_RS03635
MIKNTIAIACSTLLLAAAAQPAMAADKPLKSVGVTVGDLANPFFVAIAKGAESGAHKINP
DAKVTVVSSKYDLNTQVGQIENFIANKVDLIVLNAADSKGVGPAVKKAQKAGIVVVAVDV
AAAGADVTVMSDNTMAGAESCKFLAEKLQGKGNVVIVNGPPVSAVMDRVTGCKAEFKKSP
GIKILSDNQNAGGSRDGGMTTMSNLLAAQPKIDAVFAINDPTAIGAELAIRQAKRSDIKW
ISGVDGAPDAERALKDSKSLFAASPAQDPYGMAAESVAIGYAVMNGRAPQQKVKLLPVKL
ITRDNVADYQGWVPAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory