Comparing HSERO_RS03640 FitnessBrowser__HerbieS:HSERO_RS03640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
45% identity, 97% coverage: 10:498/502 of query aligns to 4:488/501 of P04983
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 43% coverage: 8:223/502 of query aligns to 15:224/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 45% coverage: 9:234/502 of query aligns to 1:223/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 44% coverage: 10:228/502 of query aligns to 3:218/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 44% coverage: 10:228/502 of query aligns to 3:218/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 44% coverage: 10:228/502 of query aligns to 3:218/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 44% coverage: 10:228/502 of query aligns to 3:218/242 of 2oljA
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 43% coverage: 13:226/502 of query aligns to 6:220/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 43% coverage: 13:226/502 of query aligns to 6:220/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 43% coverage: 13:226/502 of query aligns to 6:220/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 43% coverage: 13:226/502 of query aligns to 6:220/353 of Q97UY8
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 46% coverage: 8:239/502 of query aligns to 2:231/648 of P75831
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
24% identity, 47% coverage: 10:246/502 of query aligns to 4:254/254 of 1g6hA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
24% identity, 45% coverage: 10:234/502 of query aligns to 1:223/240 of 4ymuJ
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
26% identity, 43% coverage: 11:224/502 of query aligns to 7:220/375 of 2d62A
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 41% coverage: 23:226/502 of query aligns to 13:207/348 of 3d31A
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
24% identity, 47% coverage: 10:245/502 of query aligns to 4:253/253 of 1g9xB
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
28% identity, 45% coverage: 10:236/502 of query aligns to 3:231/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
28% identity, 45% coverage: 10:236/502 of query aligns to 3:231/592 of 5lj7A
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
29% identity, 46% coverage: 10:238/502 of query aligns to 4:231/257 of 8wm7D
>HSERO_RS03640 FitnessBrowser__HerbieS:HSERO_RS03640
IPVDMTQTPLLQMRGIRKSFGATLALSDMHLTIRPGEIHALMGENGAGKSTLMKVLSGVH
APDQGEILLDGRPVALRDPGASRAAGINLIYQELAVAPNISVAANVFMGSELRTRLGLID
HAAMRSRTDAVLRQLGAGFGASDLAGRLSIAEQQQVEIARALVHRSRIVIMDEPTAALSE
RETEQLFNVVRRLRDEGLAIIYISHRMAEVYALADRVTVLRDGSFVGELVRDEIDSERIV
QMMVGRSLSEFYQHQRIAPADAAQLPTVMQVRALAGGKIRPASFDVRAGEVLGFAGLVGA
GRTELARLLFGADPRSGGDILLEGRPVHIDQPRAAMRAGIAYVPEDRKGQGLFLQMAVAA
NATMNVASRHTRLGLVRSRSLGGVARAAIQRLNVKVAHPETPVGKLSGGNQQKVLLARWL
EIAPKVLILDEPTRGVDIYAKSEIYQLVHRLASQGVAVVVISSELPEVIGICDRVLVMRE
GMITGELAGAAITQENIMRLAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory