Comparing HSERO_RS03850 FitnessBrowser__HerbieS:HSERO_RS03850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
33% identity, 91% coverage: 27:423/438 of query aligns to 23:434/453 of 6s4gA
Sites not aligning to the query:
7q9xAAA Probable aminotransferase
33% identity, 91% coverage: 27:423/438 of query aligns to 24:435/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
33% identity, 91% coverage: 27:423/438 of query aligns to 24:435/455 of 4a6tC
Sites not aligning to the query:
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
33% identity, 91% coverage: 35:434/438 of query aligns to 3:380/384 of 5ti8B
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
33% identity, 89% coverage: 34:423/438 of query aligns to 2:403/423 of 4a6rA
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
33% identity, 89% coverage: 34:423/438 of query aligns to 3:407/427 of 4ba5A
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
32% identity, 96% coverage: 16:437/438 of query aligns to 13:449/450 of 6gwiB
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
31% identity, 92% coverage: 35:435/438 of query aligns to 4:419/422 of 7qx3A
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
31% identity, 92% coverage: 28:431/438 of query aligns to 26:445/454 of 7ypmA
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
30% identity, 96% coverage: 16:435/438 of query aligns to 12:440/443 of 7qx0B
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
31% identity, 92% coverage: 28:431/438 of query aligns to 26:445/455 of 7ypnD
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
31% identity, 95% coverage: 16:431/438 of query aligns to 15:444/448 of 6io1B
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
30% identity, 94% coverage: 26:435/438 of query aligns to 19:447/453 of 6g4dB
Sites not aligning to the query:
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
30% identity, 94% coverage: 26:435/438 of query aligns to 19:447/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
30% identity, 94% coverage: 26:435/438 of query aligns to 19:447/451 of 6g4eA
Sites not aligning to the query:
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
29% identity, 96% coverage: 16:437/438 of query aligns to 16:460/460 of 5kr6B
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
30% identity, 93% coverage: 32:438/438 of query aligns to 32:459/459 of 5kquC
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
30% identity, 92% coverage: 32:434/438 of query aligns to 30:453/455 of 5kr5A
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
29% identity, 94% coverage: 21:430/438 of query aligns to 16:435/443 of 6fyqA
Sites not aligning to the query:
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
29% identity, 93% coverage: 32:438/438 of query aligns to 33:458/458 of 5kr3A
>HSERO_RS03850 FitnessBrowser__HerbieS:HSERO_RS03850
MNHFIGHALARPGDDHHTLSSAFLRRLSQGAGHAIVRGAGMQVWDAHDACLLDGVCGLYG
NTLGHGHAALAAAARPMSLPAADPLAAQLALNAALSARLSAAGARVLSASTHEIAWQAML
RAVRHYWTAVGQPDRRLIITCHDGEPEAAVSGRGRRSAPEDSLRIAAPDWFGHDGYLNEY
EFGLAAARTLEQRILDLGPEHVAAFVAHAFTGASGLLHPPYSYWPEIQRICSRHHVLLCI
DEGIGGCGRTGKWFAHTQLRFSPDIVLLAQGLTSALAPLAALVLSPPMADTLAAVEGALP
VDGRIDQADPTATAIALANLRALDEGGLARQVEHDTGLYLQHCLRERFDNHPLVGDIQGN
GMLAALQLSPDPARRARFADEAAAGIDCARQALAQGVLVRASAARILLAPPMIATHADID
GLVERLGAAVDASARRML
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory