Comparing HSERO_RS04240 FitnessBrowser__HerbieS:HSERO_RS04240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
42% identity, 96% coverage: 3:323/334 of query aligns to 10:330/336 of A3QCW5
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
33% identity, 90% coverage: 24:324/334 of query aligns to 3:302/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
33% identity, 90% coverage: 24:324/334 of query aligns to 3:302/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
33% identity, 90% coverage: 24:324/334 of query aligns to 3:302/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
33% identity, 90% coverage: 24:324/334 of query aligns to 3:302/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
33% identity, 90% coverage: 24:324/334 of query aligns to 4:303/310 of 7bbrA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
33% identity, 91% coverage: 22:324/334 of query aligns to 3:300/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
33% identity, 91% coverage: 22:324/334 of query aligns to 2:299/303 of 4p9kA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
32% identity, 89% coverage: 27:324/334 of query aligns to 3:297/303 of 4pddA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
33% identity, 89% coverage: 27:324/334 of query aligns to 3:297/301 of 4pdhA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
31% identity, 83% coverage: 37:313/334 of query aligns to 12:285/300 of 4n8yA
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
33% identity, 88% coverage: 29:321/334 of query aligns to 6:304/314 of 4p8bA
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
32% identity, 75% coverage: 43:292/334 of query aligns to 19:267/304 of 4xeqB
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
32% identity, 81% coverage: 44:315/334 of query aligns to 26:290/304 of 4x8rA
Sites not aligning to the query:
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
30% identity, 70% coverage: 20:253/334 of query aligns to 1:235/312 of 4oanA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
31% identity, 95% coverage: 1:318/334 of query aligns to 2:315/329 of P44542
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
29% identity, 87% coverage: 27:315/334 of query aligns to 3:289/301 of 4x04A
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
31% identity, 87% coverage: 28:318/334 of query aligns to 4:291/304 of 2cexA
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
31% identity, 87% coverage: 28:318/334 of query aligns to 5:292/310 of 3b50A
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
30% identity, 87% coverage: 28:318/334 of query aligns to 4:291/305 of 2cexB
Sites not aligning to the query:
>HSERO_RS04240 FitnessBrowser__HerbieS:HSERO_RS04240
MKLKSILLAMTAAAIVSTNAFAQQPIVIKFSHVVANDTPKGKAAERFKELAEKATKGRVK
IEVYPNSTLYKDKEELEALQLGAVQMLAPSLAKFGPLGVKEFEVFDLPYIFPTKEVLYRV
TEGPIGKDLFKKLEPKGITGLAYWDNGFKVMSANKPLHHPADFRGLKMRIQSSKVLDAQM
RALGANPQVLAFSEVYQALQTGVVDGTENPPSNLYTQKMHEVQKHVTVSNHGYLGYAVIV
NKKFWDGLPSDIRTQLEGAMKDATKYANAIAQQENDAALAAVEKTGKTTVYRLTDAEKAE
WRKALLPVQQQMASRIGKDLIDAVNKESAALGQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory