Comparing HSERO_RS04700 FitnessBrowser__HerbieS:HSERO_RS04700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WQB3 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
45% identity, 98% coverage: 5:568/575 of query aligns to 42:643/644 of P9WQB3
Sites not aligning to the query:
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
46% identity, 98% coverage: 5:568/575 of query aligns to 25:576/577 of 3figB
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
46% identity, 98% coverage: 5:568/575 of query aligns to 25:576/576 of 3hpzB
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
46% identity, 98% coverage: 5:568/575 of query aligns to 25:573/573 of 3hq1A
1sr9A Crystal structure of leua from mycobacterium tuberculosis (see paper)
46% identity, 98% coverage: 5:568/575 of query aligns to 25:573/573 of 1sr9A
3hpsA Crystal structure of mycobacterium tuberculosis leua complexed with ketoisocaproate (kic)
46% identity, 98% coverage: 5:568/575 of query aligns to 25:575/575 of 3hpsA
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
29% identity, 62% coverage: 38:392/575 of query aligns to 11:340/379 of 4ov4A
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
29% identity, 62% coverage: 38:392/575 of query aligns to 11:342/380 of 4ov9A
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
29% identity, 54% coverage: 34:344/575 of query aligns to 10:308/517 of Q9JZG1
Sites not aligning to the query:
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
28% identity, 52% coverage: 34:332/575 of query aligns to 7:293/308 of 3rmjB
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
25% identity, 65% coverage: 21:391/575 of query aligns to 3:370/409 of 6e1jA
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 69% coverage: 34:432/575 of query aligns to 88:454/503 of Q9FN52
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 61% coverage: 21:368/575 of query aligns to 70:412/506 of Q9FG67
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
23% identity, 63% coverage: 23:386/575 of query aligns to 14:346/399 of 6ktqA
Q8F3Q1 (R)-citramalate synthase CimA; LiCMS; EC 2.3.3.21 from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) (see 2 papers)
28% identity, 26% coverage: 208:356/575 of query aligns to 174:320/516 of Q8F3Q1
Sites not aligning to the query:
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
26% identity, 56% coverage: 34:354/575 of query aligns to 7:308/376 of O87198
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
25% identity, 56% coverage: 34:354/575 of query aligns to 6:301/347 of 3a9iA
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
25% identity, 56% coverage: 34:354/575 of query aligns to 7:302/314 of 2zyfA
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
25% identity, 56% coverage: 34:354/575 of query aligns to 7:300/312 of 2ztjA
3bliA Crystal structure of the catalytic domain of licms in complexed with pyruvate and acetyl-coa (see paper)
27% identity, 22% coverage: 208:336/575 of query aligns to 168:294/311 of 3bliA
Sites not aligning to the query:
>HSERO_RS04700 FitnessBrowser__HerbieS:HSERO_RS04700
MLTDPSQKYRAIAPVDLPDRRWPSRTLRQAPTWLSTDLRDGNQALFEPMNRERKLRLFHE
LVRIGFKEIEVGFPAASRIDFETVRHLIDEHLIPDDVTPMVMTQLRADLITETVKSVAGA
RRVIVHFYNAIAPAWREIVFGMSVPQIITLVEDHIALFRRLTAVHPETEWILQYSPETFC
MAELEVSLEVCNAAIRAWDAGPRRRMIINLPTTVEVSTPNVFADQIEWMDRRLERREHLI
LSVHPHNDRGTAVACAEQAMLAGAQRVEGCLFGNGERSGNVDVVTLALNLYTQGIAPGLD
FSDIAALARVAEECTALPIHPRHPYVGDLVFTAFSGSHQDAIAKGFAAQRPDAPWRVPYL
PIDPTDLGRTYDSIVRVNSQSGKGGIAFLLQRDHHITMPRRMQVEFSAIVQALADASETE
LTSEHLWDVFERTYLAPVQASPDFSDRTSLAPALEQRRFIYRSHCLHPHPDGERIVLELA
DTEGNVRTVEGSGNGPIAATVAALGLALRIDSYEERSLGVGVGADAQALAIVEAALPTVP
GSRFGVGRHENITTASIMAVLSAASRFAGEEQGKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory