Comparing HSERO_RS04980 FitnessBrowser__HerbieS:HSERO_RS04980 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
50% identity, 100% coverage: 1:344/345 of query aligns to 1:343/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
50% identity, 100% coverage: 1:344/345 of query aligns to 2:344/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
50% identity, 100% coverage: 1:344/345 of query aligns to 2:344/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
50% identity, 100% coverage: 1:344/345 of query aligns to 2:344/344 of 6cvlD
3c4jA Abc protein artp in complex with atp-gamma-s
41% identity, 70% coverage: 1:241/345 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
41% identity, 70% coverage: 1:241/345 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
41% identity, 70% coverage: 1:241/345 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
41% identity, 70% coverage: 1:241/345 of query aligns to 3:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
40% identity, 70% coverage: 1:241/345 of query aligns to 1:240/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
41% identity, 70% coverage: 1:241/345 of query aligns to 2:240/241 of 4u00A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 68% coverage: 7:240/345 of query aligns to 32:266/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 68% coverage: 7:240/345 of query aligns to 32:266/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
38% identity, 66% coverage: 7:234/345 of query aligns to 32:260/260 of 7ahdC
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
41% identity, 64% coverage: 1:220/345 of query aligns to 1:220/222 of 8i6rB
8g4cB Bceabs atpgs high res tm (see paper)
37% identity, 63% coverage: 1:218/345 of query aligns to 3:224/248 of 8g4cB
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
42% identity, 58% coverage: 1:200/345 of query aligns to 2:201/220 of 8tzjA
7tchB Bceab e169q variant atp-bound conformation (see paper)
37% identity, 63% coverage: 1:218/345 of query aligns to 2:223/245 of 7tchB
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
40% identity, 62% coverage: 1:215/345 of query aligns to 1:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
40% identity, 62% coverage: 1:215/345 of query aligns to 1:215/219 of 8w6iD
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 79% coverage: 1:273/345 of query aligns to 17:283/378 of P69874
Sites not aligning to the query:
>HSERO_RS04980 FitnessBrowser__HerbieS:HSERO_RS04980
MIEIQAVTQRFGNVEAVRKVDLSIRKGEIFGIIGRSGAGKSTLVRTLNLLNRPTSGRIVL
DGQDLTSLSAAQLREARRGIGMIFQHFNLLSSRSVYDNIALPLELAGKSKAEIAAKVEPL
LELVGLTALRDRYPAQISGGQKQRVGIARALANDPKVLLSDEATSALDPETTRSILELLR
KINKELGLTIVLITHQMEVIKQICDRVAVMEAGQVIEQGEVLDVFRQPRHEVTRALIGDV
IAHELPKGVLARLRERLARADAGQGTDHLFRFAFTGNDVDQPHLSEAVRRFNLDFNILHG
QIDEIQGQAFGSLAILANGTQDNINQAMQYLREQGVVVEELNHVI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory