Comparing HSERO_RS05065 FitnessBrowser__HerbieS:HSERO_RS05065 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
44% identity, 99% coverage: 1:323/327 of query aligns to 7:338/343 of 3lzkC
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
28% identity, 50% coverage: 103:264/327 of query aligns to 90:243/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
28% identity, 50% coverage: 103:264/327 of query aligns to 90:243/290 of 8gsrA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
26% identity, 69% coverage: 38:264/327 of query aligns to 25:242/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
26% identity, 69% coverage: 38:264/327 of query aligns to 25:242/280 of 6j5xA
>HSERO_RS05065 FitnessBrowser__HerbieS:HSERO_RS05065
MKLATLPDGSLDGALLLVSRDQRHAVPVPQIAASLLDAVQRWDQVQPLLQERYEALNQGG
LTEAIAFDPRQCIAPLPRSPQWLDASAFLNHGRLMEEAFKTPPIPHFDTVPVMYQGASDD
FLGPYQDVALPSEEDGIDFEGEFGVIVGPVPMGVQASQALQAVRLLVQINDWSLRALGPH
EMKTGFGFLQAKPSTAFAPMAVTPDELGPAWRDGRVQMRLQVQWNGQPFGHPHGGEMNFS
FGELIAHAARSRRLTAGTVIGSGTVSNQSRAAGSACIAERRVIEKIDHGDIRTGFMRFGD
EVSMQACFDDGRSGPFGLLQQRVVPAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory