Comparing HSERO_RS05090 FitnessBrowser__HerbieS:HSERO_RS05090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
36% identity, 96% coverage: 1:482/501 of query aligns to 7:480/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 46% coverage: 4:233/501 of query aligns to 7:228/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 44% coverage: 1:218/501 of query aligns to 20:224/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 47% coverage: 1:233/501 of query aligns to 5:228/241 of 4u00A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 45% coverage: 2:224/501 of query aligns to 8:232/254 of 1g6hA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
29% identity, 47% coverage: 1:235/501 of query aligns to 9:244/375 of 2d62A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 45% coverage: 2:224/501 of query aligns to 8:232/253 of 1g9xB
1g291 Malk (see paper)
29% identity, 47% coverage: 1:235/501 of query aligns to 6:241/372 of 1g291
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
32% identity, 42% coverage: 14:223/501 of query aligns to 22:223/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 42% coverage: 14:223/501 of query aligns to 25:226/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 42% coverage: 14:222/501 of query aligns to 22:222/222 of 7arlD
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
29% identity, 42% coverage: 11:219/501 of query aligns to 18:222/232 of 1f3oA
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 42% coverage: 14:223/501 of query aligns to 24:225/229 of 7v8iD
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 44% coverage: 1:218/501 of query aligns to 6:211/393 of P9WQI3
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 45% coverage: 4:228/501 of query aligns to 11:227/343 of P30750
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
28% identity, 45% coverage: 1:223/501 of query aligns to 5:213/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
28% identity, 45% coverage: 1:223/501 of query aligns to 5:213/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
28% identity, 45% coverage: 1:223/501 of query aligns to 5:213/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
28% identity, 45% coverage: 1:223/501 of query aligns to 5:213/371 of 3puvA
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
28% identity, 45% coverage: 1:223/501 of query aligns to 3:211/367 of 1q12A
>HSERO_RS05090 FitnessBrowser__HerbieS:HSERO_RS05090
LQGIHKRFAGVHALRGVDLTIHAGEIYHLLGENGCGKSTLIKIIAGAQPPSEGEIYIQGQ
RVAELTPLASLSLGIETVYQDLSLLPNMSVAENVALSEQLVHHQGRLARLFDRHALNQTA
ARALRAVNLPADADFLDTRVDELPIATRQLIAIARAIATSARMVIMDEPTTSLTQKEVDA
LVKVINGLRANGVAVLFVSHKLDECFAIGGQAIVFRDGEKVAQGPIQQFTKAQLGQLMTG
KQLSQERYRVDAQLHKPLMEVRALGRHGAFEDVSFALRQGEILGITGLLDSGRNELALAL
AGVEPARAGQITLEGQPLSLRNPGDAITHGIGYVPEDRISEGLFLDKSIRDNIVTTILRK
LRGKFGALDAAACQRFSTDTVRQLQIATPDVDRPVQSLSGGNQQRVLIGRWLAINPRVLI
LHGPTVGVDVGSKDIIYRIIQDLAQRGLGVILISDDLPELLQNCDNLLLMKRGRIVRRYA
VEGLAESELFHDLVSEQSQES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory