Comparing HSERO_RS05095 FitnessBrowser__HerbieS:HSERO_RS05095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
28% identity, 74% coverage: 43:291/335 of query aligns to 15:260/278 of 6guqA
Sites not aligning to the query:
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
26% identity, 90% coverage: 35:335/335 of query aligns to 13:321/321 of 4pz0A
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
28% identity, 74% coverage: 43:291/335 of query aligns to 20:265/283 of 6gt9A
Sites not aligning to the query:
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
26% identity, 84% coverage: 35:317/335 of query aligns to 10:303/321 of 4wzzA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
26% identity, 73% coverage: 33:275/335 of query aligns to 9:251/289 of 5hqjA
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
24% identity, 91% coverage: 32:335/335 of query aligns to 6:316/316 of 1tjyA
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
31% identity, 62% coverage: 68:275/335 of query aligns to 40:253/288 of 8wlbA
Sites not aligning to the query:
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
31% identity, 62% coverage: 68:275/335 of query aligns to 40:253/288 of 8wl9A
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
27% identity, 66% coverage: 43:263/335 of query aligns to 14:230/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
27% identity, 66% coverage: 43:263/335 of query aligns to 14:230/313 of 2h3hA
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
32% identity, 62% coverage: 68:275/335 of query aligns to 40:253/288 of 1rpjA
Sites not aligning to the query:
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
32% identity, 62% coverage: 68:275/335 of query aligns to 40:253/288 of 1gudA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
31% identity, 67% coverage: 27:251/335 of query aligns to 1:229/287 of 5dteB
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
25% identity, 83% coverage: 31:309/335 of query aligns to 2:282/290 of 4wutA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
25% identity, 76% coverage: 36:291/335 of query aligns to 15:263/284 of 7e7mC
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
24% identity, 91% coverage: 32:335/335 of query aligns to 4:314/314 of 3t95A
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
25% identity, 82% coverage: 32:307/335 of query aligns to 4:279/315 of 3ejwA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
25% identity, 84% coverage: 26:307/335 of query aligns to 3:291/303 of 5dkvA
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
25% identity, 80% coverage: 30:298/335 of query aligns to 5:276/295 of 4rxtA
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
28% identity, 55% coverage: 35:218/335 of query aligns to 13:192/287 of 7x0hA
Sites not aligning to the query:
>HSERO_RS05095 FitnessBrowser__HerbieS:HSERO_RS05095
MMNKKSACVLVSALAAVGFASALQAQNKPIDIVTVVKITGISWFNRMEVGVKEFAAANPG
VTTRQIGPAQSDAAQQQRLVEDLVAKKVDAIAVVSMDPPTLEPVLKRALDRGIKVVTHEA
DNQKNTLVDIEAFDNTAYGARLNDRLAACMGQAGKWSSLVGSLGSQSQVQWADGGAANAA
KKYPKMTLVDAKNESANDAEKAYAKAKEILRKHPDIKGFQGSSSLDVLGIGRAVEEAGLQ
GKVCVYGTGLPSEAAKFLESGAVGGIAFWDPKDAGLAMNKAAMMLVQGKKITDGMDLGIP
GYNKVTVKKGPGVGVIVTGQAWVEVDKKNYKQYAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory