Comparing HSERO_RS05170 FitnessBrowser__HerbieS:HSERO_RS05170 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
59% identity, 90% coverage: 33:324/324 of query aligns to 3:292/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
59% identity, 90% coverage: 33:324/324 of query aligns to 2:291/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
59% identity, 90% coverage: 33:324/324 of query aligns to 2:291/304 of 6hbmA
Sites not aligning to the query:
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
57% identity, 90% coverage: 34:323/324 of query aligns to 2:289/302 of 5ocpA
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
55% identity, 90% coverage: 32:323/324 of query aligns to 1:292/296 of 2vk2A
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
55% identity, 90% coverage: 32:323/324 of query aligns to 23:314/318 of P39325
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
36% identity, 77% coverage: 58:306/324 of query aligns to 26:264/274 of 2ioyA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
31% identity, 89% coverage: 31:318/324 of query aligns to 7:277/284 of 7e7mC
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
32% identity, 82% coverage: 35:301/324 of query aligns to 4:262/301 of 2x7xA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
29% identity, 82% coverage: 54:318/324 of query aligns to 23:284/287 of 4yo7A
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
30% identity, 78% coverage: 52:303/324 of query aligns to 18:261/270 of 4zjpA
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
29% identity, 77% coverage: 52:299/324 of query aligns to 17:257/271 of 1dbpA
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
30% identity, 75% coverage: 46:287/324 of query aligns to 15:249/292 of 2fn8A
Sites not aligning to the query:
8fxuA Thermoanaerobacter thermosaccharolyticum periplasmic glucose-binding protein glucose complex: badan conjugate attached at f17c (see paper)
27% identity, 79% coverage: 57:313/324 of query aligns to 27:310/310 of 8fxuA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
26% identity, 92% coverage: 9:307/324 of query aligns to 10:289/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
27% identity, 81% coverage: 44:307/324 of query aligns to 13:257/315 of 4rsmA
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 69% coverage: 58:279/324 of query aligns to 59:276/349 of A0QYB3
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
29% identity, 69% coverage: 58:279/324 of query aligns to 26:243/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
29% identity, 69% coverage: 58:279/324 of query aligns to 26:243/315 of 4rs3A
Sites not aligning to the query:
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
28% identity, 75% coverage: 54:296/324 of query aligns to 30:269/296 of 4irxA
Sites not aligning to the query:
>HSERO_RS05170 FitnessBrowser__HerbieS:HSERO_RS05170
MNSKRRALLGAAICLSLGSSAMSLPAFAADKPLTMGFSQVGAESEWRTANTVSIKDAAKQ
AGVNLKFADAQQKQENQVKAIRSFIAQKVDVIAFSPVVESGWETVLREAKAAKIPVILTD
RAVNVSDKSLYVTFIGSDFVEEGRRAGRWLLEKAKSMPAGDINIVELQGTVGSAPAIDRK
AGFEEVIKGEPRLKIIRSQTGDFTRAKGKEVMEAFLKAEGKKINVLYAHNDDMAIGAIQA
IEEAGMKPGKDIIIISIDGVKGAFEAMMAGKLNVTVECSPLLGPQLMQIAKDIKAGKEVP
KRITTEEGIFPAEVAAKEFPNRKY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory