Comparing HSERO_RS05195 FitnessBrowser__HerbieS:HSERO_RS05195 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
44% identity, 97% coverage: 1:502/518 of query aligns to 1:490/501 of P04983
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 43% coverage: 4:225/518 of query aligns to 3:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 43% coverage: 4:225/518 of query aligns to 3:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 43% coverage: 4:225/518 of query aligns to 3:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 43% coverage: 4:225/518 of query aligns to 3:227/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 42% coverage: 4:222/518 of query aligns to 2:216/241 of 4u00A
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 38% coverage: 20:218/518 of query aligns to 22:218/222 of 7arlD
7mdyC Lolcde nucleotide-bound
33% identity, 38% coverage: 20:218/518 of query aligns to 22:218/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 38% coverage: 20:218/518 of query aligns to 25:221/233 of P75957
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 43% coverage: 1:221/518 of query aligns to 1:222/648 of P75831
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
33% identity, 38% coverage: 20:218/518 of query aligns to 24:220/229 of 7v8iD
Sites not aligning to the query:
8ee6A Cryo-em structure of human abca7 in pe/ch nanodiscs (see paper)
33% identity, 42% coverage: 1:218/518 of query aligns to 620:831/1808 of 8ee6A
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 42% coverage: 4:221/518 of query aligns to 4:229/254 of 1g6hA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 46% coverage: 17:252/518 of query aligns to 18:256/343 of P30750
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 42% coverage: 4:221/518 of query aligns to 4:229/253 of 1g9xB
8eopA Cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state (see paper)
33% identity, 41% coverage: 5:218/518 of query aligns to 650:857/1687 of 8eopA
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
26% identity, 48% coverage: 3:252/518 of query aligns to 1:257/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
26% identity, 48% coverage: 3:252/518 of query aligns to 1:257/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
26% identity, 48% coverage: 3:252/518 of query aligns to 1:257/344 of 6cvlD
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
32% identity, 40% coverage: 17:223/518 of query aligns to 21:218/218 of 7w78A
Sites not aligning to the query:
>HSERO_RS05195 FitnessBrowser__HerbieS:HSERO_RS05195
MSNILEMRGIEKSFPGVKALNNVNLAVREGEIHAIVGENGAGKSTLMKVLSGVYPHGSYS
GDIVYKGEVRAFKDIRDSEHLGIIIIHQELALVPLLSVMENLFLGNEQARGGVIDWEQSY
VRAKELLAKVGLKESPLTQVGDLGVGKQQLIEIAKALSKEVKLLILDEPTASLNESDSDA
LLELLLELKRQGIASILISHKLNEISKVADSITVLRDGTTVDTFDCRAEPISEDRIIQHM
VGREMADRYPQRDPQIGEVIFEVRDWRVHHPLHTDRLAIKDVNMSVRAGEIVGIAGLMGA
GRTELAKSIFGRAYGKKITGQAFLHGKEVDLSTIEKAIAKGIAYVTEDRKGDGLVLEEDI
KKNISLANLGGVSERTVIDEAREYKIAADFKQQMRIRCSSVLQKVVNLSGGNQQKVVLSK
WLFSQPEVLILDEPTRGIDVGAKFEIYNIISKLAAEGKCIIMISSEMPELLGMCDRIYVM
NEGQFVGHLPKAEATQENIMRAIMRNKRIDEPGLSKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory