SitesBLAST
Comparing HSERO_RS05210 FitnessBrowser__HerbieS:HSERO_RS05210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
98% identity, 97% coverage: 8:261/261 of query aligns to 1:254/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G25), T21 (= T28), I23 (= I30), D42 (= D49), I43 (= I50), C68 (= C75), D69 (= D76), L70 (= L77), N96 (= N103), A98 (= A105), F146 (= F153), S147 (= S154), S148 (= S155), Y161 (= Y168), K165 (= K172), P191 (= P198), G192 (= G199), W193 (= W200), V194 (= V201), R198 (= R205)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
54% identity, 98% coverage: 4:260/261 of query aligns to 2:257/258 of 5wjsA
- active site: G27 (= G29), S152 (= S155), Y162 (≠ F165), Y165 (= Y168), K169 (= K172)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G25), T26 (= T28), I28 (= I30), D47 (= D49), L48 (≠ I50), D73 (= D76), L74 (= L77), N100 (= N103), A102 (= A105), L150 (≠ F153), G151 (≠ S154), S152 (= S155), K169 (= K172), P195 (= P198), G196 (= G199), W197 (= W200), V198 (= V201), K202 (≠ R205)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
34% identity, 94% coverage: 16:261/261 of query aligns to 5:247/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
34% identity, 94% coverage: 16:261/261 of query aligns to 3:245/247 of 2ewmB
- active site: G16 (= G29), S139 (= S155), Y149 (≠ F165), Y152 (= Y168), K156 (= K172)
- binding nicotinamide-adenine-dinucleotide: G12 (= G25), N15 (≠ T28), G16 (= G29), I17 (= I30), D36 (= D49), L37 (≠ I50), C59 (= C75), D60 (= D76), V61 (≠ L77), N87 (= N103), S139 (= S155), Y152 (= Y168), K156 (= K172), P182 (= P198), S183 (≠ G199), L184 (≠ W200), V185 (= V201), T189 (≠ R205)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
35% identity, 94% coverage: 16:260/261 of query aligns to 3:243/245 of 5wuwA
- active site: G16 (= G29), S140 (= S155), Y154 (= Y168), L161 (≠ T175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G25), R15 (≠ T28), I17 (= I30), Y36 (≠ D49), A37 (≠ I50), A38 (= A51), D63 (= D76), S64 (≠ L77), N90 (= N103), A91 (= A104), G92 (≠ A105), Y154 (= Y168), K158 (= K172), G185 (= G199), P186 (≠ W200), V187 (= V201)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 94% coverage: 15:260/261 of query aligns to 4:252/255 of 5itvA
- active site: G18 (= G29), S141 (= S155), Y154 (= Y168), K158 (= K172)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G25), S17 (≠ T28), G18 (= G29), I19 (= I30), D38 (= D49), I39 (= I50), T61 (≠ C75), I63 (≠ L77), N89 (= N103), G91 (≠ A105), T139 (≠ F153), S141 (= S155), Y154 (= Y168), K158 (= K172), P184 (= P198), G185 (= G199), I186 (≠ W200), I187 (≠ V201)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
35% identity, 94% coverage: 15:260/261 of query aligns to 2:245/247 of 6j7uA
- active site: G16 (= G29), S142 (= S155), Y156 (= Y168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G25), S14 (≠ G27), R15 (≠ T28), I17 (= I30), Y36 (≠ D49), V37 (≠ I50), S38 (≠ A51), S41 (≠ A54), D65 (= D76), S66 (≠ L77), N92 (= N103), A93 (= A104), G94 (≠ A105), I115 (= I126), G141 (≠ S154), S142 (= S155), Y156 (= Y168), K160 (= K172), P186 (= P198), T191 (= T203), M193 (≠ R205), N194 (≠ Q206)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
34% identity, 95% coverage: 15:261/261 of query aligns to 2:246/247 of 4jroC
- active site: G16 (= G29), S142 (= S155), Q152 (≠ F165), Y155 (= Y168), K159 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G25), S14 (≠ G27), R15 (≠ T28), G16 (= G29), I17 (= I30), N35 (vs. gap), Y36 (≠ V48), N37 (≠ D49), G38 (≠ I50), S39 (≠ A51), N63 (vs. gap), V64 (vs. gap), N90 (= N103), A91 (= A104), I93 (≠ N106), I113 (= I126), S142 (= S155), Y155 (= Y168), K159 (= K172), P185 (= P198), I188 (≠ V201), T190 (= T203)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
30% identity, 95% coverage: 15:261/261 of query aligns to 1:253/255 of 2q2qD
- active site: G15 (= G29), S138 (= S155), Y151 (= Y168), K155 (= K172), R196 (≠ W210)
- binding nicotinamide-adenine-dinucleotide: G11 (= G25), T13 (≠ G27), S14 (≠ T28), G15 (= G29), I16 (= I30), F36 (= F47), D59 (= D76), L60 (= L77), N86 (= N103), G88 (≠ A105), L109 (≠ I126), I136 (≠ F153), S138 (= S155), Y151 (= Y168), K155 (= K172), P181 (= P198), G182 (= G199), W183 (= W200), V184 (= V201), T186 (= T203), L188 (vs. gap), V189 (vs. gap)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
34% identity, 94% coverage: 16:261/261 of query aligns to 4:238/244 of 1nfqA
- active site: G17 (= G29), S139 (= S155), Y152 (= Y168), K156 (= K172)
- binding Androsterone: L91 (≠ D107), E141 (≠ S157), C149 (≠ F165), Y152 (= Y168), V193 (≠ L211), I197 (vs. gap), F198 (≠ G215)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ T28), G17 (= G29), M18 (≠ I30), D37 (= D49), L39 (≠ A51), L59 (≠ C75), D60 (= D76), V61 (≠ L77), N87 (= N103), A88 (= A104), I137 (≠ F153), S139 (= S155), Y152 (= Y168), K156 (= K172), P182 (= P198), V185 (= V201), T187 (= T203), P188 (≠ Q206), M189 (≠ I207), T190 (≠ K208)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
34% identity, 94% coverage: 16:261/261 of query aligns to 4:238/244 of 1nffA
- active site: G17 (= G29), S139 (= S155), Y152 (= Y168), K156 (= K172)
- binding nicotinamide-adenine-dinucleotide: G13 (= G25), R16 (≠ T28), G17 (= G29), M18 (≠ I30), D37 (= D49), I38 (= I50), L39 (≠ A51), L59 (≠ C75), D60 (= D76), V61 (≠ L77), N87 (= N103), A88 (= A104), G89 (≠ A105), I90 (≠ N106), I137 (≠ F153), S139 (= S155), Y152 (= Y168), K156 (= K172), P182 (= P198), V185 (= V201), T187 (= T203), P188 (≠ Q206), M189 (≠ I207), T190 (≠ K208)
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
29% identity, 94% coverage: 16:260/261 of query aligns to 3:256/267 of F1SWA0
- S142 (= S155) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (= S157) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (= Y168) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K172) mutation to A: Abolishes all oxidoreductase activity.
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 94% coverage: 16:261/261 of query aligns to 5:239/260 of P9WGT1
- I6 (≠ K17) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ TGI 28:30) binding
- D38 (= D49) binding
- V47 (≠ L58) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (≠ DL 76:77) binding
- T69 (≠ Q84) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N103) binding
- S140 (= S155) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y168) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K172) binding
- 183:191 (vs. 198:208, 36% identical) binding
7krmC Putative fabg bound to nadh from acinetobacter baumannii
33% identity, 94% coverage: 16:261/261 of query aligns to 3:242/244 of 7krmC
- active site: G18 (= G29), S140 (= S155), Y155 (= Y168)
- binding nicotinamide-adenine-dinucleotide: G12 (= G25), S15 (≠ T28), G18 (= G29), I19 (= I30), D38 (= D49), L39 (≠ I50), A60 (≠ C75), N61 (≠ D76), V62 (≠ L77), N88 (= N103), V111 (≠ I126), S140 (= S155), Y155 (= Y168), K159 (= K172), I188 (≠ V201), T190 (= T203)
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
32% identity, 94% coverage: 16:261/261 of query aligns to 4:245/247 of 3rwbA
- active site: G17 (= G29), S140 (= S155), Y153 (= Y168), K157 (= K172)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S155), N141 (≠ I156), T142 (≠ S157), M150 (≠ F165), Y153 (= Y168), L185 (≠ W200), H196 (≠ D212)
- binding nicotinamide-adenine-dinucleotide: G13 (= G25), Q16 (≠ T28), G17 (= G29), I18 (= I30), D37 (= D49), I38 (= I50), D60 (= D76), I61 (≠ L77), N87 (= N103), A88 (= A104), S89 (≠ A105), I138 (≠ F153), S140 (= S155), Y153 (= Y168), K157 (= K172), P183 (= P198), L185 (≠ W200), I186 (≠ V201), S188 (≠ T203), G190 (≠ Q206), V191 (≠ I207)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
32% identity, 94% coverage: 16:261/261 of query aligns to 4:245/247 of 3ndrA
- active site: G17 (= G29), S140 (= S155), Y153 (= Y168), K157 (= K172)
- binding nicotinamide-adenine-dinucleotide: G13 (= G25), Q16 (≠ T28), G17 (= G29), I18 (= I30), D37 (= D49), I38 (= I50), D60 (= D76), I61 (≠ L77), N87 (= N103), A88 (= A104), S89 (≠ A105), V110 (≠ I126), I138 (≠ F153), S140 (= S155), Y153 (= Y168), K157 (= K172), P183 (= P198), L185 (≠ W200), I186 (≠ V201), S188 (≠ T203), G190 (≠ Q206), V191 (≠ I207)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
32% identity, 93% coverage: 16:259/261 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G29), S145 (= S155), F155 (= F165), Y158 (= Y168), K162 (= K172), K203 (≠ E213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G25), T17 (≠ G27), D18 (≠ T28), G19 (= G29), I20 (= I30), S39 (vs. gap), R40 (vs. gap), K41 (vs. gap), N44 (vs. gap), H65 (≠ A64), V66 (≠ A65), N92 (= N103), A94 (= A105), S145 (= S155), Y158 (= Y168), K162 (= K172), P188 (= P198), G189 (= G199), L190 (≠ W200), I191 (≠ V201), T193 (= T203), F195 (≠ R205), S196 (≠ Q206)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
32% identity, 93% coverage: 16:259/261 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ G162) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (= F165) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ G181) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
32% identity, 93% coverage: 16:259/261 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G25), M16 (≠ I30), D35 (= D49), I36 (= I50), I62 (≠ L77), N88 (= N103), G90 (≠ A105), I138 (≠ F153), S140 (= S155), Y152 (= Y168), K156 (= K172), I185 (≠ V201)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
32% identity, 93% coverage: 16:259/261 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ T28) binding
- D36 (= D49) binding
- D62 (= D76) binding
- I63 (≠ L77) binding
- N89 (= N103) binding
- Y153 (= Y168) binding
- K157 (= K172) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>HSERO_RS05210 FitnessBrowser__HerbieS:HSERO_RS05210
MSNTPQNVQLASFPSLKGKRVFITGGGTGIGAAIVEAFAQQGAHVAFVDIATEASEALCN
EVAAAGHPKPLFRHCDLRDIPAFQATIAELQAQLGDFDVLVNNAANDQRHKLEEVTLEYW
NDRIAINQRPSFFAVQSVVEGMKRRGGGSIINFSSISWHQSGGGFPVYTTAKASTLGLTR
GLARDLGPHKIRVNTVTPGWVMTERQIKLWLDEEGKKAIARNQCLQGDLLPWHLARMVLF
LAADDSAMCTAQEFIVDAGWV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory