SitesBLAST
Comparing HSERO_RS05240 FitnessBrowser__HerbieS:HSERO_RS05240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gvxA Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, with bound NADP and l-fucose
77% identity, 100% coverage: 1:257/258 of query aligns to 1:257/258 of 4gvxA
- active site: G18 (= G18), S140 (= S140), T150 (= T150), Y153 (= Y153), K157 (= K157), W194 (= W194)
- binding beta-L-fucopyranose: N94 (= N94), S140 (= S140), K141 (= K141), Q147 (= Q147), Y153 (= Y153), A184 (= A184), E185 (= E185), Y191 (= Y191), W194 (= W194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), S17 (= S17), G18 (= G18), I19 (= I19), R39 (= R39), H40 (≠ S40), E63 (= E63), L64 (= L64), N90 (= N90), I138 (≠ V138), S139 (= S139), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), V186 (= V186), T188 (= T188), L190 (= L190), Y191 (= Y191)
4gloA Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, with bound NAD
77% identity, 100% coverage: 1:257/258 of query aligns to 1:257/258 of 4gloA
- active site: G18 (= G18), S140 (= S140), T150 (= T150), Y153 (= Y153), K157 (= K157)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), I19 (= I19), A38 (= A38), R39 (= R39), V62 (≠ L62), E63 (= E63), L64 (= L64), N90 (= N90), A91 (= A91), I138 (≠ V138), S139 (= S139), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), V186 (= V186), L190 (= L190)
4gkbB Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, unliganded structure
77% identity, 100% coverage: 1:257/258 of query aligns to 1:257/258 of 4gkbB
A0A0H3KNE7 L-fucose dehydrogenase; EC 1.1.1.435 from Burkholderia multivorans (strain ATCC 17616 / 249) (see paper)
77% identity, 100% coverage: 1:257/258 of query aligns to 1:257/258 of A0A0H3KNE7
- S17 (= S17) binding
- I19 (= I19) binding
- R39 (= R39) binding
- H40 (≠ S40) binding
- E63 (= E63) binding
- L64 (= L64) binding
- N90 (= N90) binding
- N94 (= N94) binding
- S140 (= S140) binding
- K141 (= K141) binding
- Q147 (= Q147) binding
- Y153 (= Y153) binding ; binding
- K157 (= K157) binding
- A184 (= A184) binding
- E185 (= E185) binding
- V186 (= V186) binding
- T188 (= T188) binding
6ds1B Crystal structure of cj0485 dehydrogenase in complex with NADP+ (see paper)
48% identity, 100% coverage: 1:258/258 of query aligns to 1:258/260 of 6ds1B
- binding magnesium ion: I61 (≠ L62), D62 (≠ E63)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), K17 (≠ S17), G18 (= G18), I19 (= I19), S38 (≠ A38), R39 (= R39), D62 (≠ E63), L63 (= L64), N89 (= N90), A90 (= A91), I138 (≠ V138), V139 (≠ S139), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), A184 (= A184), V186 (= V186)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
35% identity, 98% coverage: 3:254/258 of query aligns to 1:245/251 of H9XP47
- N15 (≠ S17) binding
- M17 (≠ I19) binding
- D36 (≠ R39) binding
- D60 (≠ E63) binding
- V61 (≠ L64) binding
- N87 (= N90) binding
- S138 (= S140) binding ; binding
- V139 (≠ K141) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ T142) binding
- Y151 (= Y153) binding ; binding ; binding
- K155 (= K157) binding
- V184 (= V186) binding
- T186 (= T188) binding
- RDK 197:199 (≠ LDA 205:207) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
35% identity, 98% coverage: 5:256/258 of query aligns to 5:249/252 of 6vspB
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
35% identity, 98% coverage: 5:256/258 of query aligns to 3:247/251 of 6vspA
- active site: G16 (= G18), S138 (= S140), Y151 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), N15 (≠ S17), G16 (= G18), M17 (≠ I19), D36 (≠ R39), W37 (≠ S40), W37 (≠ S40), A38 (= A41), I59 (≠ L62), D60 (≠ E63), V61 (≠ L64), N87 (= N90), A88 (= A91), G89 (= G92), V90 (= V93), V110 (≠ R112), T136 (≠ V138), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), S182 (≠ A184), L183 (≠ E185), V184 (= V186), T186 (= T188), N187 (≠ P189), M188 (≠ L190), T189 (≠ Y191)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
35% identity, 97% coverage: 5:254/258 of query aligns to 3:245/251 of 6xewA
- active site: G16 (= G18), S138 (= S140), Y151 (= Y153)
- binding r,3-hydroxybutan-2-one: S138 (= S140), S140 (≠ T142), Y151 (= Y153)
- binding s,3-hydroxybutan-2-one: S138 (= S140), Y151 (= Y153), S182 (≠ A184)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), N15 (≠ S17), G16 (= G18), M17 (≠ I19), D36 (≠ R39), W37 (≠ S40), W37 (≠ S40), A38 (= A41), I59 (≠ L62), D60 (≠ E63), V61 (≠ L64), N87 (= N90), A88 (= A91), G89 (= G92), V110 (≠ R112), T136 (≠ V138), S138 (= S140), Y151 (= Y153), K155 (= K157), S182 (≠ A184), L183 (≠ E185), V184 (= V186), T186 (= T188), N187 (≠ P189), M188 (≠ L190), T189 (≠ Y191)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
37% identity, 97% coverage: 3:251/258 of query aligns to 2:250/252 of 1vl8B
- active site: G17 (= G18), S143 (= S140), I154 (≠ T150), Y157 (= Y153), K161 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), R16 (≠ S17), G17 (= G18), L18 (≠ I19), S37 (≠ A38), R38 (= R39), C63 (≠ L62), D64 (≠ E63), V65 (≠ L64), A91 (≠ N90), A92 (= A91), G93 (= G92), I94 (≠ V93), V114 (≠ R112), I141 (≠ V138), S143 (= S140), Y157 (= Y153), K161 (= K157), P187 (= P183), G188 (≠ A184), Y190 (≠ V186), T192 (= T188), M194 (≠ L190), T195 (≠ Y191)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 97% coverage: 3:251/258 of query aligns to 3:253/255 of 5itvA
- active site: G18 (= G18), S141 (= S140), Y154 (= Y153), K158 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (= S17), G18 (= G18), I19 (= I19), D38 (≠ A38), I39 (≠ R39), T61 (≠ L62), I63 (≠ L64), N89 (= N90), G91 (= G92), T139 (≠ V138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (≠ A184), I186 (≠ E185), I187 (≠ V186)
4qecA Elxo with NADP bound (see paper)
30% identity, 94% coverage: 8:250/258 of query aligns to 3:245/248 of 4qecA
- active site: G13 (= G18), N111 (= N113), S139 (= S140), Y152 (= Y153), K156 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ S17), G13 (= G18), I14 (= I19), S33 (≠ A38), R34 (= R39), K38 (≠ P42), D59 (≠ E63), V60 (≠ L64), N86 (= N90), A87 (= A91), G88 (= G92), I137 (≠ V138), Y152 (= Y153), K156 (= K157), P182 (= P183), I185 (≠ V186)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
33% identity, 96% coverage: 3:249/258 of query aligns to 1:244/247 of 4jroC
- active site: G16 (= G18), S142 (= S140), Q152 (≠ T150), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (≠ S17), G16 (= G18), I17 (= I19), N35 (≠ F37), Y36 (≠ A38), N37 (≠ R39), G38 (≠ S40), S39 (≠ A41), N63 (≠ L59), V64 (≠ F60), N90 (= N90), A91 (= A91), I93 (≠ V93), I113 (≠ R112), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), I188 (≠ V186), T190 (= T188)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
33% identity, 96% coverage: 5:251/258 of query aligns to 5:259/261 of 6zzsD
- active site: G18 (= G18), S143 (= S140), Y156 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (= S17), I19 (= I19), D38 (≠ A38), M39 (≠ R39), D64 (≠ E63), V65 (≠ L64), N91 (= N90), A92 (= A91), G93 (= G92), M141 (≠ V138), A142 (≠ S139), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P183), G187 (≠ A184), V189 (= V186), T191 (= T188), L193 (= L190)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ N94), S143 (= S140), N145 (≠ T142), K153 (≠ T150), Y156 (= Y153), Q197 (≠ W194)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
33% identity, 96% coverage: 5:251/258 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G18), S142 (= S140), Y155 (= Y153)
- binding acetoacetic acid: Q94 (≠ N94), S142 (= S140), K152 (≠ T150), Y155 (= Y153), Q196 (≠ W194)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), S16 (= S17), G17 (= G18), I18 (= I19), D37 (≠ A38), M38 (≠ R39), D63 (≠ E63), V64 (≠ L64), N90 (= N90), A91 (= A91), G92 (= G92), M140 (≠ V138), A141 (≠ S139), S142 (= S140), Y155 (= Y153), K159 (= K157), Y187 (≠ E185), V188 (= V186), T190 (= T188)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
33% identity, 95% coverage: 5:249/258 of query aligns to 3:236/239 of 4nbtA
- active site: G16 (= G18), S132 (= S140), Y145 (= Y153), K149 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), K15 (≠ S17), G16 (= G18), L17 (≠ I19), D36 (≠ S40), L37 (≠ A41), L52 (= L62), N53 (≠ E63), V54 (≠ L64), N80 (= N90), A81 (= A91), G82 (= G92), I130 (≠ V138), S132 (= S140), Y145 (= Y153), K149 (= K157), P177 (= P183), G178 (≠ A184), I180 (≠ V186), T182 (= T188)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
31% identity, 95% coverage: 5:249/258 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G18), N111 (= N113), S139 (= S140), Q149 (≠ T150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (= D95), K98 (≠ E100), S139 (= S140), N146 (≠ Q147), V147 (≠ G148), Q149 (≠ T150), Y152 (= Y153), F184 (≠ E185), M189 (≠ L190), K200 (≠ A207)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ S17), G18 (= G18), I19 (= I19), D38 (≠ S40), F39 (≠ A41), V59 (≠ L62), D60 (≠ E63), V61 (≠ L64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ V93), T137 (≠ V138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), F184 (≠ E185), T185 (≠ V186), T187 (= T188), M189 (≠ L190)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
31% identity, 95% coverage: 5:249/258 of query aligns to 11:262/267 of Q9LBG2
- 17:42 (vs. 11:35, 50% identical) binding
- E103 (vs. gap) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
31% identity, 95% coverage: 5:249/258 of query aligns to 2:253/258 of 1iy8A
- active site: G15 (= G18), S143 (= S140), Q153 (≠ T150), Y156 (= Y153), K160 (= K157)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (= S17), G15 (= G18), L16 (≠ I19), D35 (≠ F37), V36 (≠ A38), A62 (vs. gap), D63 (≠ E63), V64 (≠ L64), N90 (= N90), G92 (= G92), I93 (≠ V93), T141 (≠ V138), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P183), G187 (≠ A184), T191 (= T188), P192 (= P189), M193 (≠ L190)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 96% coverage: 5:251/258 of query aligns to 3:246/248 of 6ixmC
- active site: G16 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (= S17), G16 (= G18), I17 (= I19), D36 (≠ A38), I37 (≠ R39), A61 (≠ L62), D62 (≠ E63), T63 (≠ L64), N89 (= N90), A90 (= A91), M140 (≠ V138), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), A186 (= A184), Y187 (≠ E185), I188 (≠ V186), L192 (= L190)
Query Sequence
>HSERO_RS05240 FitnessBrowser__HerbieS:HSERO_RS05240
LDLNLQDKVVIVTGGASGIGAAISLQLAAEGAIPVVFARSAPESQFWERLTAVQPRAALF
QLELQDDARCREAVAGTIERFGRLDGLVNNAGVNDSVGLEAGRDEFVASLERNLIHYYVM
AHYCVPHLKATRGAIINVSSKTAVTGQGNTSGYCASKGAQLSLTREWAAALRDDGVRVNA
LIPAEVMTPLYEKWIATFDHPQEKLDAITSKIPLGKRFTTSEEMADMAVFLLSERSSHTT
GQWIFVDGGYTHLDRALT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory