Comparing HSERO_RS05250 FitnessBrowser__HerbieS:HSERO_RS05250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
48% identity, 95% coverage: 22:514/520 of query aligns to 4:494/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 42% coverage: 21:239/520 of query aligns to 1:215/241 of 4u00A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 43% coverage: 19:240/520 of query aligns to 1:230/253 of 1g9xB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 41% coverage: 22:236/520 of query aligns to 1:212/240 of 4ymuJ
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 43% coverage: 19:240/520 of query aligns to 1:230/254 of 1g6hA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
30% identity, 42% coverage: 22:240/520 of query aligns to 4:216/285 of 4yerA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 42% coverage: 22:239/520 of query aligns to 1:220/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 42% coverage: 22:239/520 of query aligns to 2:221/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 42% coverage: 22:239/520 of query aligns to 2:221/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 42% coverage: 22:239/520 of query aligns to 2:221/344 of 3tuiC
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 39% coverage: 36:239/520 of query aligns to 14:207/348 of 3d31A
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
30% identity, 42% coverage: 27:244/520 of query aligns to 7:226/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 42% coverage: 27:244/520 of query aligns to 10:229/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
30% identity, 41% coverage: 27:240/520 of query aligns to 7:222/222 of 7arlD
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 46% coverage: 22:258/520 of query aligns to 11:246/265 of P07821
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 42% coverage: 22:239/520 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 42% coverage: 22:239/520 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 42% coverage: 22:239/520 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 42% coverage: 22:239/520 of query aligns to 3:216/242 of 2oljA
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
29% identity, 42% coverage: 27:244/520 of query aligns to 9:228/229 of 7v8iD
>HSERO_RS05250 FitnessBrowser__HerbieS:HSERO_RS05250
MQEDKETSTTGVAASSSSSVPVIALRNVCKRFPGVLALDNCQFELAAGEVHALMGENGAG
KSTLMKILSGVYQRDSGDILLDGKPVEITEPRQAQALGIGIIHQELNLMNHLSAAQNIFI
GREPRKAMGLFIDEDELNRQAAAIFARMRLDMDPSTPVGELTVARQQMVEIAKALSFDSR
VLIMDEPTAALNNAEIAELFRIIRDLQAQGVGIVYISHKMDELRQIADRVSVMRDGKYIA
TVPMQETSMDTIISMMVGRALDGEQRIPPDTSRNDVVLEVRGLNRGRAIRDVSFTLRKGE
ILGFAGLMGAGRTEVARAIFGADPLEAGEIIIHGGKAVIKSPADAVAHGIGYLSEDRKHF
GLAVGMDVQANIALSSMGRFTRVGFMDQRAIREAAQMYVRQLAIKTPSVEQQARLLSGGN
QQKIVIAKWLLRDCDILFFDEPTRGIDVGAKSEIYKLLDALAEQGKAIVMISSELPEVLR
MSHRVLVMCEGRITGELARADATQEKIMQLATQRESAVAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory