Comparing HSERO_RS05320 FitnessBrowser__HerbieS:HSERO_RS05320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
42% identity, 98% coverage: 1:493/502 of query aligns to 4:491/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 45% coverage: 1:225/502 of query aligns to 1:223/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 45% coverage: 1:225/502 of query aligns to 2:223/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 43% coverage: 1:217/502 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 43% coverage: 1:217/502 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 43% coverage: 1:217/502 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 43% coverage: 1:217/502 of query aligns to 3:216/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 45% coverage: 1:225/502 of query aligns to 1:228/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 45% coverage: 1:225/502 of query aligns to 2:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 45% coverage: 1:225/502 of query aligns to 2:229/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 45% coverage: 1:225/502 of query aligns to 2:229/344 of 6cvlD
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 43% coverage: 1:217/502 of query aligns to 4:222/648 of P75831
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 47% coverage: 9:242/502 of query aligns to 12:241/285 of 4yerA
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
31% identity, 44% coverage: 2:224/502 of query aligns to 5:217/249 of 4hluC
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 44% coverage: 12:233/502 of query aligns to 16:237/280 of 5x40A
Sites not aligning to the query:
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
31% identity, 44% coverage: 2:224/502 of query aligns to 4:213/247 of 4zirB
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 39% coverage: 17:211/502 of query aligns to 23:215/330 of P9WQK5
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 46% coverage: 2:232/502 of query aligns to 3:230/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 46% coverage: 2:232/502 of query aligns to 3:230/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 46% coverage: 2:232/502 of query aligns to 3:230/238 of 6s8gA
>HSERO_RS05320 FitnessBrowser__HerbieS:HSERO_RS05320
MLQLTGIKKNFGPVTVLRGVDLEVRAGEVHALLGENGAGKSTLMKILCGIVRPDAGEIRI
DGQPCRFDSYRAAIAGGVGVVFQEFSLIPYLDAVDNMFLARELRSRWGWLQRAAMRRRAQ
EIIGQLGVAIPLDVPVCKLSVAQQQFVEIAKALALDARILVLDEPTATLTPAEVEHLFAV
MRSLRAQGVAIIFISHHLEEIFEICDRITVLRDGAYVATCATAEVDQARLVEMMVGRRIE
NCFPPKPAKGGEGEGEVVLEVHALQLRRQAPVSQFQLRRGEILGFAGLVGSGRTETVLAM
LGAHAALSCKLSMHGVPLRFADPAQALQAGIGLLPESRKEQGLITSFSILHNVSLNNYGK
YRLGGLFLDRRREQQATEAAMQRVRVKAPGAQVRVDTLSGGNQQKVVIARWINHAMKVLI
FDEPTRGIDVGAKSEIYQLMREFTAQGYSILMISSELPEVVGMADRVCVFRGGGIVATLE
GEAVNAEEIMTHATTGRIRHAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory