SitesBLAST
Comparing HSERO_RS05340 FitnessBrowser__HerbieS:HSERO_RS05340 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q920P0 L-xylulose reductase; XR; Dicarbonyl/L-xylulose reductase; EC 1.1.1.10 from Rattus norvegicus (Rat) (see paper)
43% identity, 100% coverage: 1:240/241 of query aligns to 3:243/244 of Q920P0
- S136 (= S133) mutation to A: Loss of activity.
- Q137 (≠ I134) mutation to M: Slightly reduced activity. Loss of activity for sugars; when associated with F-143 and L-146.
- L143 (≠ F140) mutation to F: Slightly reduced activity. Loss of activity for sugars; when associated with M-137 and L-146.
- H146 (= H143) mutation to L: Slightly reduced activity. Loss of activity for sugars; when associated with M-137; F-143 and L-146.
- Y149 (= Y146) mutation to F: Loss of activity.
- K153 (= K150) mutation to M: Loss of activity.
- N190 (≠ A187) mutation to V: Slightly reduced activity. Loss of activity for sugars; when associated with S-191.
- W191 (= W188) mutation to F: Slightly reduced activity.; mutation to S: Slightly reduced activity. Loss of activity for sugars; when associated with V-190.
3d3wA Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. (see paper)
42% identity, 100% coverage: 1:240/241 of query aligns to 3:243/244 of 3d3wA
- active site: G18 (= G16), S136 (= S133), H146 (= H143), Y149 (= Y146), K153 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), G16 (= G14), K17 (≠ R15), G18 (= G16), I19 (= I17), S38 (≠ A36), R39 (= R37), T40 (= T38), V59 (= V56), L61 (= L58), N83 (≠ S80), A84 (= A81), A85 (≠ G82), V106 (= V103), V134 (≠ I131), S135 (≠ T132), S136 (= S133), Y149 (= Y146), K153 (= K150), P179 (= P176), T180 (= T177), V182 (≠ T179), T184 (= T181), S185 (≠ E182), M186 (≠ L183), G187 (≠ A184)
1pr9A Human l-xylulose reductase holoenzyme (see paper)
42% identity, 100% coverage: 1:240/241 of query aligns to 3:243/244 of 1pr9A
- active site: G18 (= G16), S136 (= S133), H146 (= H143), Y149 (= Y146), K153 (= K150)
- binding dihydrogenphosphate ion: S136 (= S133), C138 (≠ A135)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), G16 (= G14), K17 (≠ R15), G18 (= G16), I19 (= I17), S38 (≠ A36), R39 (= R37), T40 (= T38), L61 (= L58), N83 (≠ S80), A85 (≠ G82), V106 (= V103), V134 (≠ I131), Y149 (= Y146), K153 (= K150), T180 (= T177), V182 (≠ T179), T184 (= T181), M186 (≠ L183)
Q7Z4W1 L-xylulose reductase; XR; Carbonyl reductase II; Dicarbonyl/L-xylulose reductase; Kidney dicarbonyl reductase; kiDCR; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; EC 1.1.1.10 from Homo sapiens (Human) (see 2 papers)
42% identity, 100% coverage: 1:240/241 of query aligns to 3:243/244 of Q7Z4W1
- 11:40 (vs. 9:38, 50% identical) binding
- N107 (= N104) mutation N->L,D: Loss of function. Probably due to defects in formation of the active site and binding of coenzyme.
- S136 (= S133) binding
- K153 (= K150) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
1cydA Carbonyl reductase complexed with NADPH and 2-propanol (see paper)
38% identity, 100% coverage: 1:240/241 of query aligns to 1:241/242 of 1cydA
- active site: G16 (= G16), S134 (= S133), L144 (≠ H143), Y147 (= Y146), K151 (= K150)
- binding isopropyl alcohol: S134 (= S133), Y147 (= Y146), V188 (≠ A187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), G14 (= G14), K15 (≠ R15), I17 (= I17), R37 (= R37), T38 (= T38), D58 (= D57), L59 (= L58), N81 (≠ S80), A83 (≠ G82), V104 (= V103), V132 (≠ I131), S134 (= S133), Y147 (= Y146), K151 (= K150), P177 (= P176), T178 (= T177), V179 (≠ I178), V180 (≠ T179), T182 (= T181), M184 (≠ L183), G185 (≠ A184)
P08074 Carbonyl reductase [NADPH] 2; Adipocyte protein P27; AP27; Lung carbonyl reductase; LCR; NADPH-dependent carbonyl reductase 2; EC 1.1.1.184 from Mus musculus (Mouse) (see 2 papers)
38% identity, 100% coverage: 1:240/241 of query aligns to 3:243/244 of P08074
- 11:39 (vs. 9:37, 48% identical) binding
- T38 (≠ A36) mutation to R: Converts the coenzyme specificity from NADP to NAD.
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
38% identity, 100% coverage: 1:240/241 of query aligns to 4:245/246 of 4hp8B
- active site: G19 (= G16), S138 (= S133), V148 (≠ H143), Y151 (= Y146), K155 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), N17 (≠ G14), T18 (≠ R15), G19 (= G16), L20 (≠ I17), R40 (= R37), R41 (≠ T38), D63 (= D57), F64 (≠ L58), N85 (≠ S80), G87 (= G82), I88 (= I83), I136 (= I131), Y151 (= Y146), K155 (= K150), P181 (= P176), G182 (≠ T177), I184 (≠ T179), T186 (= T181), N188 (≠ L183), T189 (≠ A184)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
40% identity, 97% coverage: 6:239/241 of query aligns to 6:252/256 of 7do7A
- active site: G16 (= G16), S146 (= S133), Y159 (= Y146)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), R15 (= R15), G16 (= G16), I17 (= I17), S37 (≠ T38), D66 (= D57), A67 (≠ L58), N93 (≠ S80), A94 (= A81), G95 (= G82), I96 (= I83), V144 (≠ I131), S145 (≠ T132), S146 (= S133), Y159 (= Y146), K163 (= K150), P189 (= P176), G190 (≠ T177), I192 (≠ T179), T194 (= T181), I196 (≠ L183)
- binding beta-L-rhamnopyranose: F99 (≠ L86), S146 (= S133), S148 (≠ A135), Q156 (≠ H143), Y159 (= Y146), N197 (≠ A184), D235 (≠ P222), M236 (≠ D223), R238 (≠ A225)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
40% identity, 97% coverage: 6:239/241 of query aligns to 6:252/256 of 7b81A
- active site: G16 (= G16), S146 (= S133), Y159 (= Y146)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S14 (≠ G14), R15 (= R15), I17 (= I17), D66 (= D57), A67 (≠ L58), N93 (≠ S80), A94 (= A81), G95 (= G82), I96 (= I83), T116 (≠ V103), V144 (≠ I131), S146 (= S133), Y159 (= Y146), K163 (= K150), P189 (= P176), G190 (≠ T177), I192 (≠ T179), T194 (= T181), I196 (≠ L183)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 100% coverage: 1:241/241 of query aligns to 1:244/244 of P0AEK2
- GASR 12:15 (≠ GAGR 12:15) binding
- T37 (≠ R37) binding
- NV 59:60 (≠ DL 57:58) binding
- N86 (≠ S80) binding
- Y151 (= Y146) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 146:150) binding
- A154 (≠ S149) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K150) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T179) binding
- E233 (≠ A230) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
34% identity, 100% coverage: 1:241/241 of query aligns to 1:244/244 of 6t77A
- active site: G16 (= G16), S138 (= S133), Y151 (= Y146)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (= R15), T37 (≠ R37), L58 (≠ V56), N59 (≠ D57), V60 (≠ L58), A87 (= A81), G88 (= G82), I89 (= I83)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 100% coverage: 1:241/241 of query aligns to 1:244/244 of P0A2C9
- M125 (≠ R119) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ L220) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S221) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
32% identity, 100% coverage: 1:240/241 of query aligns to 6:246/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), D19 (≠ G14), L22 (≠ I17), I42 (≠ R37), D65 (= D57), M66 (≠ L58), N92 (≠ S80), A93 (= A81), G94 (= G82), L115 (≠ V103), I143 (= I131), S145 (= S133), Y158 (= Y146), K162 (= K150), G189 (≠ T177), M191 (≠ T179), T193 (= T181), N195 (≠ L183)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
33% identity, 100% coverage: 1:241/241 of query aligns to 4:247/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ G14), R18 (= R15), I20 (= I17), T40 (≠ R37), N62 (≠ D57), V63 (≠ L58), N89 (≠ S80), A90 (= A81), I92 (= I83), V139 (≠ I131), S141 (= S133), Y154 (= Y146), K158 (= K150), P184 (= P176), G185 (≠ T177), I187 (≠ T179), T189 (= T181), M191 (≠ L183)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
35% identity, 100% coverage: 2:241/241 of query aligns to 1:243/243 of 1q7bA
- active site: G15 (= G16), E101 (≠ G96), S137 (= S133), Q147 (≠ H143), Y150 (= Y146), K154 (= K150)
- binding calcium ion: E232 (≠ A230), T233 (≠ V231)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), R14 (= R15), T36 (≠ R37), N58 (≠ D57), V59 (≠ L58), N85 (≠ S80), A86 (= A81), G87 (= G82), I88 (= I83), S137 (= S133), Y150 (= Y146), K154 (= K150), P180 (= P176), G181 (≠ T177), I183 (≠ T179)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
35% identity, 100% coverage: 1:241/241 of query aligns to 2:241/241 of 5t2uA
- active site: G17 (= G16), T135 (≠ S133), T145 (≠ H143), Y148 (= Y146), K152 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), G17 (= G16), R38 (= R37), D39 (≠ T38), R42 (≠ D41), D60 (= D57), L61 (= L58), N83 (≠ S80), A84 (= A81), Y87 (≠ N84), I133 (= I131), T135 (≠ S133), Y148 (= Y146), K152 (= K150), P178 (= P176), P180 (≠ I178), T181 (= T179), T183 (= T181), T185 (≠ L183), T186 (≠ A184)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
34% identity, 100% coverage: 2:241/241 of query aligns to 1:243/243 of 1q7cA
- active site: G15 (= G16), S137 (= S133), Q147 (≠ H143), F150 (≠ Y146), K154 (= K150)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), R14 (= R15), A35 (= A36), T36 (≠ R37), L57 (≠ V56), N58 (≠ D57), V59 (≠ L58), G87 (= G82), I88 (= I83)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 99% coverage: 3:240/241 of query aligns to 3:238/240 of 2d1yA
- active site: G16 (= G16), S135 (= S133), N145 (≠ H143), Y148 (= Y146), K152 (= K150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), R15 (= R15), I17 (= I17), D36 (≠ R37), L37 (≠ T38), R38 (≠ A39), V55 (= V56), D56 (= D57), L57 (= L58), N83 (≠ S80), A84 (= A81), A85 (≠ G82), I86 (= I83), V133 (≠ I131), S135 (= S133), Y148 (= Y146), K152 (= K150), P178 (= P176), G179 (≠ T177), I181 (≠ T179), T183 (= T181), A185 (vs. gap), V186 (vs. gap)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
32% identity, 99% coverage: 1:239/241 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G16), S142 (= S133), Q152 (≠ H143), Y155 (= Y146), K159 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (= R15), G16 (= G16), I17 (= I17), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (≠ A34), S39 (≠ L35), N63 (vs. gap), V64 (≠ I54), N90 (≠ S80), A91 (= A81), I93 (= I83), I113 (≠ V103), S142 (= S133), Y155 (= Y146), K159 (= K150), P185 (= P176), I188 (≠ T179), T190 (= T181)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
39% identity, 97% coverage: 6:239/241 of query aligns to 6:243/247 of 7do6A
- active site: G16 (= G16), S146 (= S133), Y159 (= Y146)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (= R15), G16 (= G16), I17 (= I17), H36 (≠ R37), S37 (≠ T38), G42 (≠ A43), D66 (= D57), A67 (≠ L58), N93 (≠ S80), A94 (= A81), G95 (= G82), I96 (= I83), T116 (≠ V103), S146 (= S133), Y159 (= Y146), K163 (= K150), I192 (≠ W188)
Query Sequence
>HSERO_RS05340 FitnessBrowser__HerbieS:HSERO_RS05340
MSFAGKTVIITGAGRGIGRACALLLAQRGAQVIALARTASDLARLQEEIGARVIAVDLSD
PAAARRAMAEAGTADFLINSAGINVLESVLEMSDEGYEAVLGVNLRAALITCQAFARMRI
AQGGGGAMVNITSIAGHRGFEQHLCYAASKAGLEGATRVLARELGPHGIRVNAVAPTITL
TELAEAAWSDPAKSGPMMARHPSARFASPEDVARSIAMLLSPDAAMLNGAVVPVDGGFLA
V
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory