Comparing HSERO_RS05350 FitnessBrowser__HerbieS:HSERO_RS05350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
32% identity, 45% coverage: 60:222/359 of query aligns to 32:203/358 of P45131
Sites not aligning to the query:
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
27% identity, 50% coverage: 45:225/359 of query aligns to 19:205/350 of 2vavB
Sites not aligning to the query:
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
27% identity, 50% coverage: 45:225/359 of query aligns to 18:204/347 of 2vatA
Sites not aligning to the query:
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
28% identity, 48% coverage: 45:217/359 of query aligns to 18:204/374 of D2Z028
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 52% coverage: 33:217/359 of query aligns to 70:276/504 of Q10341
Sites not aligning to the query:
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
30% identity, 34% coverage: 95:217/359 of query aligns to 82:211/387 of Q6FEQ3
Sites not aligning to the query:
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
28% identity, 45% coverage: 95:254/359 of query aligns to 78:245/367 of 8f2lA
Sites not aligning to the query:
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
28% identity, 45% coverage: 95:254/359 of query aligns to 78:245/368 of 7rytB
Sites not aligning to the query:
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
28% identity, 45% coverage: 95:254/359 of query aligns to 79:246/366 of 6puxA
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
23% identity, 48% coverage: 45:217/359 of query aligns to 9:189/346 of 5w8oB
>HSERO_RS05350 FitnessBrowser__HerbieS:HSERO_RS05350
MTLTFRLRHVARLLLSSAALMLCSAATQAADPPRPVEGDWVAPRFQFHTGQTLENLRLHY
VTLGDRANPAVLVLHGTYQSAQAMLSKDFGGQLFGPGQPLDASKYFIIIPDGIGVGKSSK
PSDGLRAAFPQYNYADMVLAQYRMLTEGMGITHLRLIIGNSMGGMQTWIWGGTYPGFADG
LVPMASQPTEMASRNWMMRRMLVESIKQDPAWNNGNYTTQPPSLRLANNMFVFATNGGTL
AYQAMAGSHAQADKLVDERLAAPVTADANDFIYQWGSSADYNAAPGLSKIKAPVLAINSA
DDERNPPETGVMQAALKEVPSAQLLLIPASAETRGHGTTGMARFYVRELEQFIKGLPAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory