Comparing HSERO_RS05400 FitnessBrowser__HerbieS:HSERO_RS05400 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
24% identity, 73% coverage: 56:256/277 of query aligns to 56:263/281 of P94530
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
31% identity, 29% coverage: 147:227/277 of query aligns to 357:439/490 of 4ki0F
Sites not aligning to the query:
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
31% identity, 29% coverage: 147:227/277 of query aligns to 372:454/514 of P02916
Sites not aligning to the query:
>HSERO_RS05400 FitnessBrowser__HerbieS:HSERO_RS05400
MNKPPLFPPYTSLVERAWFFASRGFNLLVLLFLVSPILVMIPLSFSDSSFLMYPIKSFSL
RWYENLFSSDDWVRAAQNSFIVAPAATVIATVLGTLAAVGLNKADFRGKGILMAILISPM
IVPVVVVGVGVYLFFARIGLSDSYLGLILAHAALGAPFVVTTVLATLQGFNHNLVRASLS
LGASPLRTFFRVTLPVIAPGLISGALFAFATSFDEVVLTLFVAGPEQATLPRQMFAGIKD
NISPTIAALATILIIFSTCLLLALEWLRGRNKAAARF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory